Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 2.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 4.1e-03
astrocytic glioma -1.500 1.4e-02
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
glioblastoma -1.500 3.9e-05
medulloblastoma, large-cell -1.800 1.9e-05
oligodendroglioma -1.700 2.2e-02
osteosarcoma -1.496 4.1e-05
ovarian cancer -2.600 8.8e-14
primitive neuroectodermal tumor -1.100 5.3e-03

Synonym

Accession Q8IWP9 E1P591 Q32NC7 Q66K67 Q96E23 Q9Y430
Symbols C6orf80
CCRL1AP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAVGSLRVAEGGP      1 - 70
NTLLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPK     71 - 140
LKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVR    141 - 210
GMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS          211 - 274
//

Text Mined References (7)

PMID Year Title