Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.07
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 8.78459266346355E-14
medulloblastoma, large-cell 6234 1.87919044649255E-5
glioblastoma 5572 3.8796297024265E-5
osteosarcoma 7933 4.12521999027091E-5
atypical teratoid / rhabdoid tumor 4369 0.00249985137485972
adult high grade glioma 2148 0.00410851326379469
primitive neuroectodermal tumor 3031 0.0052731087761586
astrocytic glioma 2241 0.0143461800626021
oligodendroglioma 2849 0.0222836516556192

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.500 0.014
oligodendroglioma -1.700 0.022
osteosarcoma -1.496 0.000
atypical teratoid / rhabdoid tumor -1.300 0.002
glioblastoma -1.500 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.005
adult high grade glioma -1.200 0.004
ovarian cancer -2.600 0.000

Synonym

Accession Q8IWP9 E1P591 Q32NC7 Q66K67 Q96E23 Q9Y430
Symbols C6orf80
CCRL1AP

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
22058212 the recurrent NUP98-CCDC28A is an oncogene that induces a rapid and transplantable myeloid neoplasm in recipient mice. They also provide additional evidence for an alternative leukemogenic mechanism for NUP98 oncogenes.

AA Sequence

MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAVGSLRVAEGGP      1 - 70
NTLLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPK     71 - 140
LKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVR    141 - 210
GMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS          211 - 274
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22058212 2012 Functional analysis of the NUP98-CCDC28A fusion protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16028218 2005 Characterization of 6q abnormalities in childhood acute myeloid leukemia and identification of a novel t(6;11)(q24.1;p15.5) resulting in a NUP98-C6orf80 fusion in a case of acute megakaryoblastic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.