Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IWN6
Symbols SPCX
CXorf52
LINC00204A
NCRNA00204
NCRNA00204A

Gene

 Compartment GO Term (0)

AA Sequence

MYVQEHRLWGLMDKPHSAPCLMSLSLSFLICNKGRNAIRVQQSTDERMDAMLLWQCPTQGTRKNHESNSS      1 - 70
LHHVPNWIFHSTIIPPNKGSKRCLRKVDWLLPRAGGVGGKRGVTADGDRVSF                       71 - 122
//

Text Mined References (2)

PMID Year Title