Property Summary

NCBI Gene PubMed Count 28
PubMed Score 730.01
PubTator Score 375.55

Knowledge Summary

Patent

No data available

Gene RIF (26)

AA Sequence

MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGV      1 - 70
GTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV                 71 - 128
//

Text Mined References (29)

PMID Year Title