Property Summary

NCBI Gene PubMed Count 28
Grant Count 48
R01 Count 27
Funding $11,142,453.01
PubMed Score 714.67
PubTator Score 375.55

Knowledge Summary

Patent

No data available

Gene RIF (26)

PMID Text
25305495 results of this meta-analysis suggested that MAPT_238bp/STH Q7R polymorphisms might modulate the risk of Parkinson's disease susceptibility
25283873 Results showed a significant interaction effect of COMT and STH polymorphisms on cognitive performances, strengthening the involvement of STH in cognitive impairments, especially in the domains commonly impaired in schizophrenia
25168738 The rs6203857 polymorphism of the saitohin gene is a genetic risk factor for Parkinson's disease.
22187337 These results suggest a possible contribution of STH gene products on the heterogeneity of core frontal executive functions deterioration in schizophrenia
21934306 Single polymorphisms within the saitohin gene were associated with increased cognitive impairment and functional dependence persons with moderate-to-advanced Alzheimer disease.
21769920 effect of Saitohin on Abl-mediated phosphorylation appears to be allele-specific, providing evidence for a new cellular function for STH
20852909 STH polymorphisms play a possibly shared role with those of serotinin transporter 5-HTTLPR gene as a susceptibility factor for Alzheimer's disease and frontotemperal lobar dementia.
20852909 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18850062 The Saitohin Q7R polymorphism is unlikely to contribute significantly to Alzheimer's disease susceptibility of the Han population in south China.
18850062 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGV      1 - 70
GTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV                 71 - 128
//

Text Mined References (29)

PMID Year Title
25305495 2014 Association of microtubule associated protein tau/Saitohin (MAPT/STH) MAPT_238bp/STH Q7R polymorphisms and Parkinson's disease: A meta-analysis.
25283873 2015 COMT and STH polymorphisms interaction on cognition in schizophrenia.
25168738 2015 Association of rs62063857 variant of the saitohin gene with Parkinson's disease.
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22187337 2012 Saitohin polymorphism and executive dysfunction in schizophrenia.
21934306 2011 Saitohin and APOE polymorphisms influence cognition and function in persons with advanced Alzheimer Disease.
21769920 2011 Saitohin, which is nested within the tau gene, interacts with tau and Abl and its human-specific allele influences Abl phosphorylation.
20852909 2010 Serotonin transporter and saitohin genes in risk of Alzheimer's disease and frontotemporal lobar dementia: preliminary findings.
18850062 2008 The Q7R polymorphism in the saitohin gene is rare in a southern Chinese population.
More...