Property Summary

NCBI Gene PubMed Count 13
Grant Count 73
R01 Count 30
Funding $16,969,845.61
PubMed Score 45.75
PubTator Score 19.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IWL3 Q9BWS7
Symbols JAC1
HSC20
DNAJC20

Gene

PDB

3BVO  

Gene RIF (4)

PMID Text
23940031 NFS1 binds preferentially to the D-state of ISCU while mtHSP70 binds preferentially to the D-state of ISCU and HSC20 binds preferentially to the S-state of ISCU.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20668094 A cysteine-rich N-terminal domain, which clearly distinguishes hHSC20 from the specialized DnaJ type III proteins of fungi and most bacteria, was found to be important for the integrity and function of the human co-chaperone.
18713742 structural analysis of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain

AA Sequence

MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT      1 - 70
RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY     71 - 140
LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE    141 - 210
AKEILTKMRYFSNIEEKIKLKKIPL                                                 211 - 235
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23940031 2013 Human mitochondrial chaperone (mtHSP70) and cysteine desulfurase (NFS1) bind preferentially to the disordered conformation, whereas co-chaperone (HSC20) binds to the structured conformation of the iron-sulfur cluster scaffold protein (ISCU).
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20729852 2010 A shared susceptibility locus in PLCE1 at 10q23 for gastric adenocarcinoma and esophageal squamous cell carcinoma.
20668094 2010 Characterization of the human HSC20, an unusual DnaJ type III protein, involved in iron-sulfur cluster biogenesis.
18713742 2008 Structure of human J-type co-chaperone HscB reveals a tetracysteine metal-binding domain.
16952052 2006 The diversity of the DnaJ/Hsp40 family, the crucial partners for Hsp70 chaperones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...