Property Summary

NCBI Gene PubMed Count 165
PubMed Score 102.64
PubTator Score 1163.19

Knowledge Summary


No data available


  Disease Sources (5)

Disease Target Count P-value
lung adenocarcinoma 2714 2.68491127346414E-6
Disease Target Count Z-score Confidence
Idiopathic pulmonary fibrosis 21 0.0 5.0
Disease Target Count Z-score Confidence
Lung disease 136 3.849 1.9
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12


  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -4.200 0.000


Accession Q8IWL2 A8K3T8 B7ZW50 E3VLD8 E3VLD9 E3VLE0 E3VLE1 G5E9J3 P07714 Q14DV4 Q5RIR5 Q5RIR7 Q6PIT0 Q8TC19 PSP-A
Symbols SPA


PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Horse OMA EggNOG
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

Gene RIF (141)

26707652 These results suggested that the measurement of SPA levels in the exhaled breath condensate may serve as a method for monitoring airway obstruction in patients with chronic obstructive pulmonary disease.
26656890 SP-A in exhaled particles from small airways may represent a promising non-invasive biomarker of disease in chronic obstructive pulmonary disease patients.
26603976 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy.
25522687 Data suggest that that surfactant protein A(SP-A) levels may be important to maintain surfactant function in the presence of high cholesterol within surfactant.
25326576 SP-A1 transcripts, which in turn negatively affect SP-A1 translation, possibly affecting SP-A1/SP-A2 ratio, with potential for clinical implication.
25058539 12 of which predicted to bind SP-A 3'UTRs.
24984162 In this study, the loci and haplotypes associated with pulmonary tuberculosis (PTB)were found mostly to be located in the SFTPA2 gene, suggesting that the effects of the SFTPA2 gene on PTB are stronger than those of SFTPA1.
24960334 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions.
24954098 This study shows that changes occur in the alveolar macrophage proteome in response to a single in vivo treatment with exogenous SP-A1 and/or SP-A2.
24939295 Results show that cloned surfactant-associated protein A (SPA) gene promoter had specific transcriptional activity in SPA high expression cells.

AA Sequence

WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF                                    211 - 248

Text Mined References (168)

PMID Year Title
26707652 2016 Expression of surfactant protein-A in exhaled breath condensate of patients with chronic obstructive pulmonary disease.
26656890 2015 Surfactant Protein A in Exhaled Endogenous Particles Is Decreased in Chronic Obstructive Pulmonary Disease (COPD) Patients: A Pilot Study.
26603976 2016 Expression and localization of collectins in feto-maternal tissues of human first trimester spontaneous abortion and abortion prone mouse model.
25522687 2015 Cholesterol-mediated surfactant dysfunction is mitigated by surfactant protein A.
25326576 2015 Regulation of translation by upstream translation initiation codons of surfactant protein A1 splice variants.
25058539 2014 Knockdown of Drosha in human alveolar type II cells alters expression of SP-A in culture: a pilot study.
25025725 2014 Identification and Quantitation of Coding Variants and Isoforms of Pulmonary Surfactant Protein A.
24984162 2014 Correlation analysis between single nucleotide polymorphisms of pulmonary surfactant protein A gene and pulmonary tuberculosis in the Han population in China.
24960334 2014 Eosinophil-associated lung diseases. A cry for surfactant proteins A and D help?
24954098 2014 Sex differences in the acute in vivo effects of different human SP-A variants on the mouse alveolar macrophage proteome.