Property Summary

NCBI Gene PubMed Count 176
PubMed Score 109.34
PubTator Score 1163.19

Knowledge Summary


No data available


  Disease (4)

Disease Target Count Z-score Confidence
Idiopathic pulmonary fibrosis 23 0.0 5.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.7e-06
Disease Target Count
Pulmonary Fibrosis, Idiopathic 12


  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -4.200 2.7e-06

Gene RIF (152)

AA Sequence

WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF                                    211 - 248

Text Mined References (179)

PMID Year Title