Property Summary

NCBI Gene PubMed Count 41
Grant Count 90
R01 Count 72
Funding $11,795,037.76
PubMed Score 207.30
PubTator Score 2174.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -3.791 0.000
lung cancer -10.400 0.000
active Crohn's disease 3.156 0.009
active ulcerative colitis 1.058 0.037
lung adenocarcinoma -2.260 0.033

Synonym

Accession Q8IWL1 A4QPA7 B2RXI6 B2RXK9 C9J9I7 E3VLC6 E3VLC7 E3VLC8 E3VLC9 P07714 Q14DV3 Q5RIR8 Q5RIR9 PSP-A
Symbols PSAP
PSPA
SP-A
SPA2
PSP-A
SFTP1
SP-2A
SPAII
COLEC5
SFTPA2B

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (32)

PMID Text
26950992 Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected.
26568241 In a Dutch cohort study of unrelated patients with idiopathic or familial interstitial pneumonia genetic analysis of SFTPA2 three new mutations in exon 6 of SFTPA2: N210T, G231R, and N171Y were identified. None were found in the control group.
26061924 Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates.
25957169 Genetic variation in SP-A2 leads to differential binding to Mycoplasma pneumoniae membranes and regulation of host responses.
25514367 Expression of SFTPA2 mRNA and total SP-A protein was significantly lower in cancer tissue.
24984162 In this study, the loci and haplotypes associated with pulmonary tuberculosis (PTB) were found mostly to be located in the SFTPA2 gene, suggesting that the effects of the SFTPA2 gene on PTB are stronger than those of SFTPA1.
24960334 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions.
24954098 This study shows that changes occur in the alveolar macrophage proteome in response to a single in vivo treatment with exogenous SP-A1 and/or SP-A2.
24950659 data suggest an effect of genetic variants of SFTPA2 on the severity of pandemic H1N1 infection
24793167 sequence variability at the 3'UTR of SFTPA1 and SFTPA2 gene variants differentially affects miRNA regulation of gene expression.
More...

AA Sequence

MWLCPLALNLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPP      1 - 70
GNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS     71 - 140
SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN    141 - 210
WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF                                    211 - 248
//

Text Mined References (41)

PMID Year Title
26950992 [ASSOCIATION OF POLYMORPHISM GENES OF SURFACTANT PROTEINS IN PATIENTS WITH INFLUENZA].
26568241 2015 SFTPA2 Mutations in Familial and Sporadic Idiopathic Interstitial Pneumonia.
26061924 2015 Human Surfactant Proteins A2 (SP-A2) and B (SP-B) Genes as Determinants of Respiratory Distress Syndrome.
25957169 2015 Genetic variation in SP-A2 leads to differential binding to Mycoplasma pneumoniae membranes and regulation of host responses.
25514367 2015 DNA methylation profile and expression of surfactant protein A2 gene in lung cancer.
24984162 2014 Correlation analysis between single nucleotide polymorphisms of pulmonary surfactant protein A gene and pulmonary tuberculosis in the Han population in China.
24960334 2014 Eosinophil-associated lung diseases. A cry for surfactant proteins A and D help?
24954098 2014 Sex differences in the acute in vivo effects of different human SP-A variants on the mouse alveolar macrophage proteome.
24950659 2014 Surfactant protein A genetic variants associate with severe respiratory insufficiency in pandemic influenza A virus infection.
24793167 2014 An 11-nt sequence polymorphism at the 3'UTR of human SFTPA1 and SFTPA2 gene variants differentially affect gene expression levels and miRNA regulation in cell culture.
More...