Property Summary

NCBI Gene PubMed Count 42
PubMed Score 218.19
PubTator Score 2174.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 3.156 9.0e-03
active ulcerative colitis 1.058 3.7e-02
lung adenocarcinoma -2.260 3.3e-02
lung cancer -8.600 1.1e-08
non-small cell lung cancer -3.791 9.9e-10

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (33)

AA Sequence

MWLCPLALNLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPP      1 - 70
GNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS     71 - 140
SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN    141 - 210
WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF                                    211 - 248
//

Text Mined References (42)

PMID Year Title