Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.72
PubTator Score 8.05

Knowledge Summary

Patent (1,942)

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.100 2.6e-05
ependymoma 1.100 3.6e-02
group 4 medulloblastoma 1.100 2.1e-04
invasive ductal carcinoma -1.092 1.0e-03
lung adenocarcinoma 1.042 1.0e-03
lung cancer 2.400 8.0e-05
medulloblastoma, large-cell 1.700 7.0e-06
non primary Sjogren syndrome sicca -1.100 2.7e-02
ovarian cancer -1.200 6.7e-03
ulcerative colitis -1.500 5.0e-06

Gene RIF (4)

AA Sequence

MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAEGKVVCSSLEL      1 - 70
AQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNR     71 - 140
IGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVR    141 - 210
DTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQD    211 - 280
GRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCP    281 - 350
PERVVNNKGDFRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV    351 - 420
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIA    421 - 490
SNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVF    491 - 560
QKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKRELRPTD    561 - 630
DSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAV    631 - 700
AARWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIIL    701 - 770
LLCLLAVIVSYIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV    771 - 840
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCW    841 - 910
MAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSL    911 - 980
ISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFVFGATSLSFSAFFVVHHCVNR    981 - 1050
EDVRLAWIMTCCPGRSSYSVQVNVQPPNSNGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQA   1051 - 1120
AAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREY   1121 - 1190
AYDVPTSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT   1191 - 1260
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETTV            1261 - 1321
//

Text Mined References (13)

PMID Year Title