Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.72
PubTator Score 8.05

Knowledge Summary

Patent (1,942)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 5.04769907917887E-6
medulloblastoma, large-cell 6234 7.001772743131E-6
lung cancer 4473 8.02376643335892E-5
invasive ductal carcinoma 2950 0.00101120679895849
lung adenocarcinoma 2714 0.0010421260225367
sonic hedgehog group medulloblastoma 1482 0.00135470643708581
ovarian cancer 8492 0.00229867391294977
non-inflammatory breast cancer 208 0.00559473862849698
ependymoma 2514 0.0150966615279146
non primary Sjogren syndrome sicca 840 0.0271768689338004
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.800 0.015
sonic hedgehog group medulloblastoma 1.200 0.001
medulloblastoma, large-cell 1.700 0.000
lung cancer 2.400 0.000
non primary Sjogren syndrome sicca -1.100 0.027
invasive ductal carcinoma -1.092 0.001
lung adenocarcinoma 1.042 0.001
non-inflammatory breast cancer -1.200 0.006
ulcerative colitis -1.500 0.000
ovarian cancer 1.400 0.002

Synonym

Accession Q8IWK6 Q6UXK9 Q86SQ5 Q8TC55
Symbols PGR21
TEM5L
GPR125

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

  TechDev Info (3)

Bryan Roth GPR125; functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model
Steve Finkbeiner Neurite and survival phenotype identified

 MGI Term (1)

Gene RIF (3)

PMID Text
24902969 ID4 and GPR125 are expressed on partially overlapping spermatogonial populations and are more broadly expressed in normal adult human testis. ID4 and GPR125 could be used for identifying previously unrecognized human spermatogonial subpopulations
20677014 Observational study of gene-disease association. (HuGE Navigator)
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAEGKVVCSSLEL      1 - 70
AQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNR     71 - 140
IGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVR    141 - 210
DTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQD    211 - 280
GRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCP    281 - 350
PERVVNNKGDFRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV    351 - 420
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIA    421 - 490
SNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVF    491 - 560
QKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKRELRPTD    561 - 630
DSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAV    631 - 700
AARWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIIL    701 - 770
LLCLLAVIVSYIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV    771 - 840
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCW    841 - 910
MAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSL    911 - 980
ISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFVFGATSLSFSAFFVVHHCVNR    981 - 1050
EDVRLAWIMTCCPGRSSYSVQVNVQPPNSNGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQA   1051 - 1120
AAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREY   1121 - 1190
AYDVPTSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT   1191 - 1260
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETTV            1261 - 1321
//

Text Mined References (13)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24902969 2014 Evaluation of candidate spermatogonial markers ID4 and GPR125 in testes of adult human cadaveric organ donors.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15021905 2004 Direct binding of the human homologue of the Drosophila disc large tumor suppressor gene to seven-pass transmembrane proteins, tumor endothelial marker 5 (TEM5), and a novel TEM5-like protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...