Property Summary

NCBI Gene PubMed Count 26
Grant Count 22
R01 Count 16
Funding $1,919,589.54
PubMed Score 11.67
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.100 0.000
astrocytoma -1.100 0.034
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
adult high grade glioma -1.300 0.002
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.400 0.000
pituitary cancer -1.100 0.002

Gene RIF (10)

PMID Text
26653856 These unexpected features support a model in which GCC185 collapses onto the Golgi surface, perhaps by binding to Rab GTPases, to mediate vesicle tethering.
22159419 Deletion of the ARL4A-interacting region of GCC185 results in inability to maintain Golgi structure and modulate endosome-to-Golgi transport.
21875948 Two distinct domains of GCC185 are needed either for Golgi structure maintenance or transport vesicle tethering. The domain needed for vesicle tethering binds to the clathrin adaptor AP-1.
19703403 Study demonstrates that Golgi recruitment of endogenous GCC185 does not involve Rab6A/A' and Arl1.
18946081 Results show that GCC185 contains at least six binding sites for as many as 14 different Rab GTPases across its entire length.
18243103 Rab and Arl GTPase family members cooperate in the localization of GCC2.
17488291 GCC2 is required for endosome-to-Golgi transport and maintenance of Golgi structure.
16885419 These data assign a specific pathway to an interesting, TGN-localized protein and suggest that GCC185 may participate in the docking of late endosome-derived, Rab9-bearing transport vesicles at the TGN.
15654769 The ability of the four mammalian GRIP domain proteins, p230, golgin-97, GCC88, and GCC185 to interact is reported.
12446665 targeting to subcompartments of trans-Golgi network by GRIP domain

AA Sequence

MEDLVQDGVASPATPGTGKSKLETLPKEDLIKFAKKQMMLIQKAKSRCTELEKEIEELRSKPVTEGTGDI      1 - 70
IKALTERLDALLLEKAETEQQCLSLKKENIKMKQEVEDSVTKMGDAHKELEQSHINYVKEIENLKNELMA     71 - 140
VRSKYSEDKANLQKQLEEAMNTQLELSEQLKFQNNSEDNVKKLQEEIEKIRPGFEEQILYLQKQLDATTD    141 - 210
EKKETVTQLQNIIEANSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENL    211 - 280
VKQCEASEKNIQKKYECELENLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLKELESQHSI    281 - 350
LKDEVTYMNNLKLKLEMDAQHIKDEFFHEREDLEFKINELLLAKEEQGCVIEKLKSELAGLNKQFCYTVE    351 - 420
QHNREVQSLKEQHQKEISELNETFLSDSEKEKLTLMFEIQGLKEQCENLQQEKQEAILNYESLREIMEIL    421 - 490
QTELGESAGKISQEFESMKQQQASDVHELQQKLRTAFTEKDALLETVNRLQGENEKLLSQQELVPELENT    491 - 560
IKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFINKLKNSHEEMDNFHKKCEREERLILELGKK    561 - 630
VEQTIQYNSELEQKVNELTGGLEETLKEKDQNDQKLEKLMVQMKVLSEDKEVLSAEVKSLYEENNKLSSE    631 - 700
KKQLSRDLEVFLSQKEDVILKEHITQLEKKLQLMVEEQDNLNKLLENEQVQKLFVKTQLYGFLKEMGSEV    701 - 770
SEDSEEKDVVNVLQAVGESLAKINEEKCNLAFQRDEKVLELEKEIKCLQEESVVQCEELKSLLRDYEQEK    771 - 840
VLLRKELEEIQSEKEALQSDLLEMKNANEKTRLENQNLLIQVEEVSQTCSKSEIHNEKEKCFIKEHENLK    841 - 910
PLLEQKELRDRRAELILLKDSLAKSPSVKNDPLSSVKELEEKIENLEKECKEKEEKINKIKLVAVKAKKE    911 - 980
LDSSRKETQTVKEELESLRSEKDQLSASMRDLIQGAESYKNLLLEYEKQSEQLDVEKERANNFEHRIEDL    981 - 1050
TRQLRNSTLQCETINSDNEDLLARIETLQSNAKLLEVQILEVQRAKAMVDKELEAEKLQKEQKIKEHATT   1051 - 1120
VNELEELQVQLQKQKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKELNQKLTNKNNKIEDLEQEI   1121 - 1190
KIQKQKQETLQEEITSLQSSVQQYEEKNTKIKQLLVKTKKELADSKQAETDHLILQASLKGELEASQQQV   1191 - 1260
EVYKIQLAEITSEKHKIHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEFESYKVRVHNV   1261 - 1330
LKQQKNKSMSQAETEGAKQEREHLEMLIDQLKIKLQDSQNNLQINVSELQTLQSEHDTLLERHNKMLQET   1331 - 1400
VSKEAELREKLCSIQSENMMMKSEHTQTVSQLTSQNEVLRNSFRDQVRHLQEEHRKTVETLQQQLSKMEA   1401 - 1470
QLFQLKNEPTTRSPVSSQQSLKNLRERRNTDLPLLDMHTVTREEGEGMETTDTESVSSASTYTQSLEQLL   1471 - 1540
NSPETKLEPPLWHAEFTKEELVQKLSSTTKSADHLNGLLRETEATNAILMEQIKLLKSEIRRLERNQERE   1541 - 1610
KSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLAAVAQGEEENASRSSGWASYLHSW   1611 - 1680
SGLR                                                                     1681 - 1684
//

Text Mined References (31)

PMID Year Title
26653856 2015 Protein flexibility is required for vesicle tethering at the Golgi.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22159419 2011 ARL4A acts with GCC185 to modulate Golgi complex organization.
21875948 2011 GCC185 plays independent roles in Golgi structure maintenance and AP-1-mediated vesicle tethering.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19703403 2009 The localization of the Golgin GCC185 is independent of Rab6A/A' and Arl1.
18946081 2009 Multiple Rab GTPase binding sites in GCC185 suggest a model for vesicle tethering at the trans-Golgi.
More...