Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
22595670 FAM116 and Rab14 therefore define an endocytic recycling pathway needed for ADAM protease trafficking and regulation of cell-cell junctions.

AA Sequence

MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSAWLHCVCVVGF      1 - 70
DLELGQAVEVIYPQHSKLTDREKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDQFDKDLP     71 - 140
VYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACND    141 - 210
VDRWPAPVPGKTLHLPIMGVVMKVRIPTCHDKPGTTQIVQLTQQVDTNISVILPTVHEVDIFRCFCPVFL    211 - 280
HSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVI    281 - 350
LGVTNPFFAKTLQHWPHIIRIGDLKPTGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQ    351 - 420
KGVQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTG    421 - 490
PQLTSRIKGDWIGLYRHFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLK    491 - 560
LKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILLKTGMT                          561 - 608
//

Text Mined References (10)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22595670 2012 Rab14 and its exchange factor FAM116 link endocytic recycling and adherens junction stability in migrating cells.
21330364 2011 DENN domain proteins: regulators of Rab GTPases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.