Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.28
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.4e-04
Breast cancer 2.400 3.1e-02
group 4 medulloblastoma 1.200 1.8e-03
juvenile dermatomyositis 1.304 5.9e-11
medulloblastoma, large-cell 1.700 1.3e-04
osteosarcoma -1.150 2.0e-03
ovarian cancer 1.200 2.0e-08
pancreatic ductal adenocarcinoma liver m... -1.669 2.0e-03
spina bifida -1.257 3.6e-02

AA Sequence

MAALGRPFSGLPLSGGSDFLQPPQPAFPGRAFPPGADGAELAPRPGPRAVPSSPAGSAARGRVSVHCKKK      1 - 70
HKREEEEDDDCPVRKKRITEAELCAGPNDWILCAHQDVEGHGVNPSVSGLSIPGILDVICEEMDQTTGEP     71 - 140
QCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVL    141 - 210
WKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL     211 - 279
//

Text Mined References (12)

PMID Year Title