Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.05
PubTator Score 8.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.000
psoriasis -1.200 0.002
breast carcinoma -1.200 0.000
fibroadenoma -1.300 0.012
invasive ductal carcinoma -1.300 0.002

Gene RIF (4)

PMID Text
25161703 A critical role for Mdp3 in the growth and metastasis of breast cancer.
24927501 Results have identified a new microtubule binding region in MAP7D3, formed by the conserved MAP7 domain and the C-terminal tail, which can bind to microtubules and promote their assembly and stability.
24614595 the amino-terminal region mediated the interaction of Mdp3 with histone deacetylase 6 (HDAC6), in addition to its association with tubulin and microtubules.
22142902 Mdp3 is a novel microtubule-binding protein that regulates microtubule assembly and stability.

AA Sequence

MMADGAAAGAGGSPSLRELRARMVAAANEIAKERRKQDVVNRVATHSSNIRSTFKPVIDGSMLKNDIKQR      1 - 70
LARERREEKRRQQDANKETQLLEKERKTKLQYEKQMEERQRKLKERKEKEEQRRIAAEEKRHQKDEAQKE     71 - 140
KFTAILYRTLERRRLADDYQQKRWSWGGSAMANSESKTANKRSASTEKLEQGTSALIRQMPLSSAGLQNS    141 - 210
VAKRKTDKERSSSLNRRDSNLHSSTDKEQAERKPRVTGVTNYVMQYVTVPLRKCTSDELRAVMFPMSTMK    211 - 280
IPPQTKVEESPLEKVETPPKASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVS    281 - 350
TYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEALPEVSVEAAPEGSLEAPPKG    351 - 420
SAEVAPKESVKGSPKESMEASPEAMVKASPKTSLEASMEASPKAKARDAPKKSEMDKQALIPIAKKRLSS    421 - 490
YTECYKWSSSPENACGLPSPISTNRQIQKNCPPSPLPLISKQSPQTSFPYKIMPIQHTLSVQSASSTVKK    491 - 560
KKETVSKTTNRCEALSQRHMIYEESGNKSTAGIMNAEAATKILTELRRLAREQREKEEEERQREEMQQRV    561 - 630
IKKSKDMAKEAVGGQAEDHLKLKDGQQQNETKKKKGWLDQEDQEAPLQKGDAKIKAQEEADKRKKEHERI    631 - 700
MLQNLQERLERKKRIEEIMKRTRKTDVNASKVTETSSHDIYEEAEADNEESDKDSLNEMFPSAILNGTGS    701 - 770
PTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSHTT    771 - 840
KTRKADETNTTSRSSAQTKSEGFHDILPKSSDTFRQ                                      841 - 876
//

Text Mined References (20)

PMID Year Title
25161703 2014 Microtubule-associated protein Mdp3 promotes breast cancer growth and metastasis.
24927501 2014 C-terminal region of MAP7 domain containing protein 3 (MAP7D3) promotes microtubule polymerization by binding at the C-terminal tail of tubulin.
24614595 2014 Microtubule stabilization by Mdp3 is partially attributed to its modulation of HDAC6 in addition to its association with tubulin and microtubules.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22142902 2011 Mdp3 is a novel microtubule-binding protein that regulates microtubule assembly and stability.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...