Property Summary

NCBI Gene PubMed Count 16
Grant Count 13
R01 Count 2
Funding $706,947.79
PubMed Score 10.12
PubTator Score 6.47

Knowledge Summary

Patent (2,009)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
osteosarcoma -1.284 0.000
tuberculosis -1.400 0.000
non-small cell lung cancer -1.049 0.000
lung cancer -2.500 0.000
group 4 medulloblastoma 1.600 0.005

Gene RIF (6)

PMID Text
22405274 Tex14 is an important mediator of kinetochore structure and function and the fidelity of chromosome separation.
20378615 Observational study of gene-disease association. (HuGE Navigator)
20176808 TEX14 prevents the completion of cytokinesis by altering the destiny of CEP55 from a nidus for abscission to an integral component of the intercellular bridge.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12471243 TEX14, also known as SgK307, contains a variant and probably inactive protein kinase domain and N-terminal ankyrin repeats.
11279525 TEX14 is specifically expressed in testis

AA Sequence

MSRAVRLPVPCPVQLGTLRNDSLEAQLHEYVKQGNYVKVKKILKKGIYVDAVNSLGQTALFVAALLGLRK      1 - 70
FVDVLVDYGSDPNHRCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDERGQNPKTWALTAGKERSTQI     71 - 140
VEFMQRCASHMQAIIQGFSYDLLKKIDSPQRLVYSPSWCGGLVQGNPNGSPNRLLKAGVISAQNIYSFGF    141 - 210
GKAMPWFQFYLTGATQMAYLGSLPVIGEKEVIQADDEPTFSFFSGPYMVMTNLVWNGSRVTVKELNLPTH    211 - 280
PHCSRLRLADLLIAEQEHSSKLRHPYLLQLMAVCLSQDLEKTRLVYERITIGTLFSVLHERRSQFPVLHM    281 - 350
EVIVHLLLQISDALRYLHFQGFIHRSLSSYAVHIISPGEARLTNLEYMLESEDRGVQRDLTRVPLPTQLY    351 - 420
NWAAPEVILQKAATVKSDIYSFSMIMQEILTDDIPWKGLDGSVVKKAVVSGNYLEADVRLPKPYYDIVKS    421 - 490
GIHVKQKDRTMNLQDIRYILKNDLKDFTGAQRTQPTESPRVQRYGLHPDVNVYLGLTSEHPRETPDMEII    491 - 560
ELKEMGSQPHSPRVHSLFTEGTLDPQAPDPCLMARETQNQDAPCPAPFMAEEASSPSTGQPSLCSFEINE    561 - 630
IYSGCLILEDDIEEPPGAASSLEADGPNQVDELKSMEEELDKMEREACCFGSEDESSSKAETEYSFDDWD    631 - 700
WQNGSLSSLSLPESTREAKSNLNNMSTTEEYLISKCVLDLKIMQTIMHENDDRLRNIEQILDEVEMKQKE    701 - 770
QEERMSLWATSREFTNAYKLPLAVGPPSLNYIPPVLQLSGGQKPDTSGNYPTLPRFPRMLPTLCDPGKQN    771 - 840
TDEQFQCTQGAKDSLETSRIQNTSSQGRPRESTAQAKATQFNSALFTLSSHRQGPSASPSCHWDSTRMSV    841 - 910
EPVSSEIYNAESRNKDDGKVHLKWKMEVKEMAKKAATGQLTVPPWHPQSSLTLESEAENEPDALLQPPIR    911 - 980
SPENTDWQRVIEYHRENDEPRGNGKFDKTGNNDCDSDQHGRQPRLGSFTSIRHPSPRQKEQPEHSEAFQA    981 - 1050
SSDTLVAVEKSYSHQSMQSTCSPESSEDITDEFLTPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFA   1051 - 1120
QPQVSGEEKFQMRKILGKNAEILPRSQFQPVRSTEDEQEETSKESPKELKEKDISLTDIQDLSSISYEPD   1121 - 1190
SSFKEASCKTPKINHAPTSVSTPLSPGSVSSAASQYKDCLESITFQVKTEFASCWNSQEFIQTLSDDFIS   1191 - 1260
VRERAKKLDSLLTSSETPPSRLTGLKRLSSFIGAGSPSLVKACDSSPPHATQRRSLPKVEAFSQHHIDEL   1261 - 1330
PPPSQELLDDIELLKQQQGSSTVLHENTASDGGGTANDQRHLEEQETDSKKEDSSMLLSKETEDLGEDTE   1331 - 1400
RAHSTLDEDLERWLQPPEESVELQDLPKGSERETNIKDQKVGEEKRKREDSITPERRKSEGVLGTSEEDE   1401 - 1470
LKSCFWKRLGWSESSRIIVLDQSDLSD                                              1471 - 1497
//

Text Mined References (19)

PMID Year Title
26392564 2015 Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
25352340 2014 Novel loci affecting iron homeostasis and their effects in individuals at risk for hemochromatosis.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
22405274 2012 Tex14, a Plk1-regulated protein, is required for kinetochore-microtubule attachment and regulation of the spindle assembly checkpoint.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20176808 2010 TEX14 interacts with CEP55 to block cell abscission.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
More...