Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.44
PubTator Score 7.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.61318036318024E-10
lung adenocarcinoma 2714 2.75686755807591E-8
posterior fossa group A ependymoma 1511 4.48968259338753E-8
atypical teratoid / rhabdoid tumor 4369 6.7663368241864E-7
psoriasis 6685 4.07222070229972E-6
glioblastoma 5572 4.47979978022062E-6
pituitary cancer 1972 2.15266291357877E-5
pediatric high grade glioma 2712 2.25985470436791E-5
interstitial cystitis 2299 9.35317521611113E-5
primitive neuroectodermal tumor 3031 1.37334507423559E-4
sonic hedgehog group medulloblastoma 1482 3.07178164346466E-4
ovarian cancer 8492 4.42955339599202E-4
ulcerative colitis 2087 5.93805727633938E-4
osteosarcoma 7933 6.28396555162409E-4
cystic fibrosis 1670 6.70601971771205E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00102093089651082
medulloblastoma, large-cell 6234 0.00106517291591816
primary pancreatic ductal adenocarcinoma 1271 0.00249531330040643
pancreatic cancer 2300 0.00881069192994631
subependymal giant cell astrocytoma 2287 0.0302678027942105

Expression

Synonym

Accession Q8IWB1 D3DRA5 Q5JU17 Q96MS8 Q9C0A9
Symbols DANGER
KIAA1754
bA127L20
bA127L20.2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16990268 DANGER appears to allosterically modulate the sensitivity of IP(3) RtoCa(2+) inhibition, which likely alters IP(3)R-mediated Ca(2+) dynamics in cells where DANGER and IP(3)R are co-expressed
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALE      1 - 70
QVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEEDELPGLGGAPLQGLTLPNKA     71 - 140
TLGHFYERCIRGATADAARTREFLEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENWQVDRPLLCHL    141 - 210
FVPFTPPEPYRFHPELWCSGRSVPLDRQGYGQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPC    211 - 280
GDMENLLCATDSLYLDTMQVMKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIP    281 - 350
VIQCDDSDLYFVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQS    351 - 420
RLTGPSGLSSYHLKTALLHLLLLRQAADWKAGQLDARLHELLCFLEKSLLQKKLHHFFIGNRKVPEAMGL    421 - 490
PEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS                 491 - 547
//

Text Mined References (17)

PMID Year Title
22514627 2012 PHYRN: a robust method for phylogenetic analysis of highly divergent sequences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17301879 2007 Ancient origin of the new developmental superfamily DANGER.
16990268 2006 DANGER, a novel regulatory protein of inositol 1,4,5-trisphosphate-receptor activity.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...