Property Summary

NCBI Gene PubMed Count 38
PubMed Score 40.32
PubTator Score 39.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.100 2.0e-02
Astrocytoma, Pilocytic 1.300 5.9e-09
ependymoma 1.200 9.6e-03
glioblastoma 1.100 3.5e-03
intraductal papillary-mucinous adenoma (... 1.600 1.8e-04
intraductal papillary-mucinous carcinoma... 1.400 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-03
lung carcinoma -1.100 3.8e-17
medulloblastoma, large-cell -1.900 1.8e-03
non-small cell lung cancer -1.041 1.2e-16
oligodendroglioma 1.300 1.5e-03
osteosarcoma -2.144 1.2e-03
ovarian cancer 1.500 1.1e-04

Gene RIF (21)

AA Sequence

MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDPRKVIYPTDSR      1 - 70
GEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCV     71 - 140
PGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKK    141 - 210
ANGVLEARQLAMRIFEDYTVSWYWIIIGLVIAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCY    211 - 280
MEYSRLRGEAGSDVSLVDLGFQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEA    281 - 350
SRAVGYVMCSLLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR    351 - 420
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALRKPDDLPAFPL    421 - 490
FSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCLMTCLKCCFWCLEKFIKFLNR    491 - 560
NAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLIVGSVGILAFFFFTHRIRIVQD    561 - 630
TAPPLNYYWVPILTVIVGSYLIAHGFFSVYGMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTN    631 - 700
KKAAES                                                                    701 - 706
//

Text Mined References (44)

PMID Year Title