Property Summary

NCBI Gene PubMed Count 35
Grant Count 13
R01 Count 10
Funding $2,433,415.75
PubMed Score 38.40
PubTator Score 39.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26601765 The differential expression pattern of CTL1 and CTL2 suggests that CTL1 is the key transporter involved in choline transport from maternal circulation and both transporters are likely involved in stromal and endothelial cell choline transport.
26593331 The Yi population of China had the highest frequency of blood donors at risk of harboring anti-HNA-3a compared to any population
26437811 Study found 38 SNPs, including one novel SNP, in 8192 nucleotides covering the CDS of the SLC44A2 gene among 302 blood donors.
25772935 Meta-analysis of 65,734 individuals identifies TSPAN15 and SLC44A2 as two susceptibility loci for venous thromboembolism.
25608003 The HNA-3 incompatibility in central Thais (33.28%) was higher than northern Thais (28.75%), corresponding to a significantly higher probability of HNA-3a alloimmunization (P<0.05) similar to Japanese and Chinese populations. This study showed the high risk of HNA-3 incompatibility and alloimmunization, especially in central Thai blood donors.
25006121 HNA-3a (CTL2) antibodies in the pathogenesis of transfusion-related acute lung injury
24846273 The findings show that, for binding to CTL2, Type 2 HNA-3a antibodies require nonpolymorphic amino acid residues in the third, and possibly the second, EC loops of CTL2
23398146 Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b.
22414054 HNA-3b/b genotype results for six different racial and ethnic groups showed that there could be a significant risk of producing anti-HNA-3a in Chinese, and Caucasian and Asian Indian blood donors, but low risk in Hispanic, African, or Native Americans.
22211383 HEK293 cells expressing full-length CTL2 proteins were useful in the detection of HNA-3 antibodies even in the presence of HLA antibodies.
More...

AA Sequence

MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDPRKVIYPTDSR      1 - 70
GEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCV     71 - 140
PGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKK    141 - 210
ANGVLEARQLAMRIFEDYTVSWYWIIIGLVIAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCY    211 - 280
MEYSRLRGEAGSDVSLVDLGFQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEA    281 - 350
SRAVGYVMCSLLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR    351 - 420
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALRKPDDLPAFPL    421 - 490
FSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCLMTCLKCCFWCLEKFIKFLNR    491 - 560
NAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDFLFLLGKLLIVGSVGILAFFFFTHRIRIVQD    561 - 630
TAPPLNYYWVPILTVIVGSYLIAHGFFSVYGMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTN    631 - 700
KKAAES                                                                    701 - 706
//

Text Mined References (41)

PMID Year Title
26601765 2015 Characterization of choline transporters in the human placenta over gestation.
26593331 2016 Genotype frequency of human neutrophil antigen-3 polymorphisms in the Yi, Han, and Tibetan populations of China.
26437811 2016 Full-length nucleotide sequences of 30 common SLC44A2 alleles encoding human neutrophil antigen-3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772935 2015 Meta-analysis of 65,734 individuals identifies TSPAN15 and SLC44A2 as two susceptibility loci for venous thromboembolism.
25608003 2015 Risk estimation of HNA-3 incompatibility and alloimmunization in Thai populations.
25006121 2014 Spotlight on pathogenesis of TRALI: HNA-3a (CTL2) antibodies.
24846273 2014 Transfusion-related acute lung injury-associated HNA-3a antibodies recognize complex determinants on choline transporter-like protein 2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398146 2013 Determination of human neutrophil antigen-1, -3, -4 and -5 allele frequencies in English Caucasoid blood donors using a multiplex fluorescent DNA-based assay.
More...