Property Summary

NCBI Gene PubMed Count 44
PubMed Score 104.07
PubTator Score 60.49

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.5e-07
Breast cancer 1.200 1.9e-06
lung cancer 1.400 3.3e-02
medulloblastoma 1.100 8.1e-04
medulloblastoma, large-cell 1.100 2.9e-05
non-small cell lung cancer 1.367 9.0e-19
osteosarcoma 1.939 1.1e-03
ovarian cancer 2.600 1.2e-06
Pick disease -1.300 1.6e-04
progressive supranuclear palsy -1.200 3.4e-02
psoriasis 1.200 1.8e-07

Protein-protein Interaction (2)

Gene RIF (31)

AA Sequence

MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEV      1 - 70
LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVN     71 - 140
QLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSES    141 - 210
TLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRI    211 - 280
FFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILAT    281 - 350
VKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL    351 - 420
SVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQD    421 - 490
KLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFPFSLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLA    491 - 560
STPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGIIIVGGVIWKTIGWKLLSVSLTMYGALYLYER    561 - 630
LSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPK    631 - 700
EIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES                                 701 - 741
//

Text Mined References (49)

PMID Year Title