Property Summary

NCBI Gene PubMed Count 38
Grant Count 71
R01 Count 33
Funding $6,490,185.98
PubMed Score 91.18
PubTator Score 60.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma 1.939 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
sonic hedgehog group medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.613 0.000
lung cancer 1.600 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.200 0.034
ovarian cancer 2.600 0.000
Breast cancer 1.200 0.000

Synonym

Accession Q8IWA4 B2RAR1 D3DNR6 O15323 O60639 Q9BZB5 Q9NWQ2
Symbols hfzo1
hfzo2

Gene

Gene RIF (25)

PMID Text
24824927 miR-19b targets 3'UTR sequences of Mfn1 genes inhibit the expression of Mfn1
24722297 A fine balance of Mfn1 levels is maintained by MARCH5-mediated quality control on acetylated Mfn1.
23713734 In a amyotrophic lateral sclerosis transgenic mouse model, Mfn1 is significantly increased in spinal cord.
23427266 A novel role for the endoplasmic reticulum-associated Gp78 ubiquitin ligase and the Mfn1 mitochondrial fusion factor in mitophagy.
22649485 Knock-out of mitofusin protein Mfn1 increased the frequency of mitochondrial fission with increased lifetime of unpaired events whereas deletion of both Mfn1 and Mfn2 resulted in an instable dynamics.
22484496 These results collectively suggest a role for Mfn1 in regulating the activation of Bax on the outer mitochondrial membrane in a GTPase-dependent manner.
21839087 mitochondrial dynamics, particularly those mediated by the mitofusins, play a role in endothelial cell function and viability.
21615408 Our data supports a model whereby the translocation of parkin to damaged mitochondria induces the degradation of mitofusin 1 leading to impaired mitochondrial fusion
21408142 The impact of mutations in endogenous PINK1 and Parkin on the ubiquitination of mitochondrial fusion and fission factors and the mitochondrial network structure, was investigated.
21173115 Mitofusin degradation by mitochondria-associated Parkin inhibits the fusion of damaged mitochondria with healthy mitochondria to facilitate the selective elimination of the former by autophagy.
More...

AA Sequence

MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEV      1 - 70
LSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVN     71 - 140
QLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSES    141 - 210
TLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRI    211 - 280
FFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILAT    281 - 350
VKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRL    351 - 420
SVLVDEFCSEFHPNPDVLKIYKSELNKHIEDGMGRNLADRCTDEVNALVLQTQQEIIENLKPLLPAGIQD    421 - 490
KLHTLIPCKKFDLSYNLNYHKLCSDFQEDIVFPFSLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLA    491 - 560
STPTAPTTPATPDNASQEELMITLVTGLASVTSRTSMGIIIVGGVIWKTIGWKLLSVSLTMYGALYLYER    561 - 630
LSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPK    631 - 700
EIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES                                 701 - 741
//

Text Mined References (43)

PMID Year Title
24824927 2014 MicroRNA-19b targets Mfn1 to inhibit Mfn1-induced apoptosis in osteosarcoma cells.
24722297 2014 MARCH5-mediated quality control on acetylated Mfn1 facilitates mitochondrial homeostasis and cell survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23933751 2013 The Parkinson's disease-linked proteins Fbxo7 and Parkin interact to mediate mitophagy.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23713734 2013 Mitochondrial fusion and fission proteins expression dynamically change in a murine model of amyotrophic lateral sclerosis.
23427266 2013 Regulation of mitophagy by the Gp78 E3 ubiquitin ligase.
22649485 2012 Multi-patterned dynamics of mitochondrial fission and fusion in a living cell.
22484496 2012 Mitofusin 1 inhibits an apoptosis-associated amino-terminal conformational change in Bax, but not its mitochondrial translocation, in a GTPase-dependent manner.
21839087 2011 Mitofusins are required for angiogenic function and modulate different signaling pathways in cultured endothelial cells.
More...