Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.17
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.52768701182412E-17
lung adenocarcinoma 2714 1.36623377699293E-7
invasive ductal carcinoma 2950 0.0236466442272618
Disease Target Count Z-score Confidence
Specific language impairment 31 4.052 2.0
Blepharitis 5 3.801 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.209 0.000
lung adenocarcinoma 1.500 0.000
invasive ductal carcinoma 1.200 0.024

Synonym

Accession Q8IW93 A6NJ04 Q5TEV2 Q6PJQ4 Q8N244
Symbols WGEF

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
24405610 overcomes the suppressive influence of miR-503 in hepatocellular carcinoma cells
18187620 Knockdown of Rho guanine nucleotide exchange factor 19 (ARHGEF19) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDCGPPATLQPHLTGPPGTAHHPVAVCQQESLSFAELPALKPPSPVCLDLFPVAPEELRAPGSRWSLGTP      1 - 70
APLQGLLWPLSPGGSDTEITSGGMRPSRAGSWPHCPGAQPPALEGPWSPRHTQPQRRASHGSEKKSAWRK     71 - 140
MRVYQREEVPGCPEAHAVFLEPGQVVQEQALSTEEPRVELSGSTRVSLEGPERRRFSASELMTRLHSSLR    141 - 210
LGRNSAARALISGSGTGAAREGKASGMEARSVEMSGDRVSRPAPGDSREGDWSEPRLDTQEEPPLGSRST    211 - 280
NERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGS    281 - 350
TFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWL    351 - 420
FSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTYQRLLLENPRF    421 - 490
PGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATKAFNALKELVQECNAS    491 - 560
VQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLL    561 - 630
LSRRKELGKFAVFVHAKMAELQVRDLSLKLQGIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALC    631 - 700
PSSPQEDKEVISEGEDCPQVQCVRTYKALHPDELTLEKTDILSVRTWTSDGWLEGVRLADGEKGWVPQAY    701 - 770
VEEISSLSARLRNLRENKRVTSATSKLGEAPV                                          771 - 802
//

Text Mined References (9)

PMID Year Title
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24405610 2014 miR-503 regulates metastatic function through Rho guanine nucleotide exchanger factor 19 in hepatocellular carcinoma.
20643356 2010 Epidermal wound repair is regulated by the planar cell polarity signaling pathway.
18256687 2008 WGEF activates Rho in the Wnt-PCP pathway and controls convergent extension in Xenopus gastrulation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485661 2004 WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.