Property Summary

NCBI Gene PubMed Count 103
PubMed Score 168.45
PubTator Score 166.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.5e-23
Atopic dermatitis 952 3.8e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -3.800 3.8e-08
psoriasis -2.000 1.5e-23

Gene RIF (97)

AA Sequence

MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR      1 - 70
NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI     71 - 140
DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF    141 - 210
RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL    211 - 280
KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG    281 - 350
EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK          351 - 414
//

Text Mined References (104)

PMID Year Title