Property Summary

NCBI Gene PubMed Count 85
PubMed Score 152.02
PubTator Score 166.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -3.800 0.000
psoriasis -2.200 0.000

Gene RIF (79)

PMID Text
27322007 Vaspin might be a useful predictive biomarker in patients with AMI, and patients with low vaspin levels might have a high risk of a MACE. In addition, vaspin might have protective effects on the improvement of LVEF after AMI.
26670468 The development of clinically manifest arthritis after follow-up was associated with baseline serum vaspin levels.
26436376 serum visceral adipose tissue-derived serpin (vaspin) levels in patients with normal glucose regulation and recently diagnosed type 2 diabetes, was investigated.
26415032 Low vaspin blood levels in patients with prolactinomas.
26199422 structural and functional results reveal the mechanistic basis of how reactive centre loop sequence and exosite interaction in vaspin enable KLK7 recognition and regulate protease inhibition
25945347 It is believed that vaspin could be regarded as a new link between obesity and related metabolic disorders, including glucose intolerance.
25915077 Mean vaspin and apelin levels were significantly lower in underweight children compared to controls
25672472 In the sepsis group, vaspin plasma concentration was about three-fold as high as in the median surgical control group.
25470626 High levels of serum vaspin is associated with obesity.
25340725 vaspin is a beneficial adipokine in obesity
More...

AA Sequence

MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR      1 - 70
NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI     71 - 140
DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF    141 - 210
RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL    211 - 280
KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG    281 - 350
EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK          351 - 414
//

Text Mined References (85)

PMID Year Title
27322007 2016 Vaspin as a Prognostic Marker in Patients with Acute Myocardial Infarction.
26670468 2015 Serum Vaspin Levels Are Associated with the Development of Clinically Manifest Arthritis in Autoantibody-Positive Individuals.
26436376 2015 Changes and clinical significance of serum vaspin levels in patients with type 2 diabetes.
26415032 2016 Serum vaspin and adiponectin levels in patients with prolactinoma.
26199422 2015 A unique serpin P1' glutamate and a conserved ?-sheet C arginine are key residues for activity, protease recognition and stability of serpinA12 (vaspin).
25945347 2015 The role of vaspin in the development of metabolic and glucose tolerance disorders and atherosclerosis.
25915077 2015 Role of circulating adipocytokines vaspin, apelin, and visfatin in the loss of appetite in underweight children: a pilot trial.
25672472 2015 Increased plasma vaspin concentration in patients with sepsis: an exploratory examination.
25470626 The comparison of serum vaspin and visfatin concentrations in obese and normal weight women.
25340725 2014 Increased vaspin levels are associated with beneficial metabolic outcome pre- and post-bariatric surgery.
More...