Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.13864289222921E-13
pilocytic astrocytoma 3086 4.34869555366093E-13
psoriasis 6685 1.17426028960218E-12
atypical teratoid / rhabdoid tumor 4369 8.06269757199842E-10
pediatric high grade glioma 2712 8.15984009989202E-9
medulloblastoma, large-cell 6234 2.20903633456551E-8
glioblastoma 5572 3.34812869648697E-7
oligodendroglioma 2849 1.57851446210974E-5
sonic hedgehog group medulloblastoma 1482 1.8956841350137E-4
osteosarcoma 7933 1.91118452540363E-4
Down syndrome 548 0.00199464967475807
astrocytoma 1493 0.00613350678270539
primitive neuroectodermal tumor 3031 0.00734069853128251
subependymal giant cell astrocytoma 2287 0.0451892579589

Synonym

Accession Q8IW70 Q5T9V7
Symbols TMEM193
C6orf137
bA444E17.5

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSPPGSAAGESAAGGGGGGGGPGVSEELTAAAAAAAADEGPAREEQRPIQPSFTKSLCRESHWKCLLLSL      1 - 70
LMYGCLGAVAWCHVTTVTRLTFSSAYQGNSLMYHDSPCSNGYVYIPLAFLLMLYAVYLVECWHCQARHEL     71 - 140
QHRVDVSSVRERVGRMQQATPCIWWKAISYHYVRRTRQVTRYRNGDAYTTTQVYHERVNTHVAEAEFDYA    141 - 210
RCGVRDVSKTLVGLEGAPATRLRFTKCFSFASVEAENAYLCQRARFFAENEGLDDYMEAREGMHLKNVDF    211 - 280
REFMVAFPDPARPPWYACSSAFWAAALLTLSWPLRVLAEYRTAYAHYHVEKLFGLEGPGSASSAGGGLSP    281 - 350
SDELLPPLTHRLPRVNTVDSTELEWHIRSNQQLVPSYSEAVLMDLAGLGTRCGGAGGGYAPSCRYGGVGG    351 - 420
PGAAGVAPYRRSCEHCQRAVSSSSIFSRSALSICASPRAGPGPGGGAGCGGSRFSLGRLYGSRRSCLWRS    421 - 490
RSGSVNEASCPTEQTRLSSQASMGDDEDDDEEEAGPPPPYHDALYFPVLIVHRQEGCLGHSHRPLHRHGS    491 - 560
CVETSL                                                                    561 - 566
//

Text Mined References (7)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7894479 1994 False association of human ESTs.