Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -3.100 3.4e-06
astrocytic glioma -1.500 3.6e-03
Astrocytoma, Pilocytic -3.500 5.3e-13
atypical teratoid / rhabdoid tumor -4.000 8.1e-10
Down syndrome -1.200 2.0e-03
ependymoma -2.200 2.7e-02
glioblastoma -3.100 2.7e-11
medulloblastoma -1.400 1.2e-03
medulloblastoma, large-cell -3.400 2.2e-08
oligodendroglioma -1.100 1.6e-05
osteosarcoma 1.002 3.6e-04
primitive neuroectodermal tumor -1.600 7.3e-03
psoriasis 1.700 1.2e-12
subependymal giant cell astrocytoma -3.440 4.5e-02

Synonym

Accession Q8IW70 Q5T9V7
Symbols TMEM193
C6orf137
bA444E17.5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSPPGSAAGESAAGGGGGGGGPGVSEELTAAAAAAAADEGPAREEQRPIQPSFTKSLCRESHWKCLLLSL      1 - 70
LMYGCLGAVAWCHVTTVTRLTFSSAYQGNSLMYHDSPCSNGYVYIPLAFLLMLYAVYLVECWHCQARHEL     71 - 140
QHRVDVSSVRERVGRMQQATPCIWWKAISYHYVRRTRQVTRYRNGDAYTTTQVYHERVNTHVAEAEFDYA    141 - 210
RCGVRDVSKTLVGLEGAPATRLRFTKCFSFASVEAENAYLCQRARFFAENEGLDDYMEAREGMHLKNVDF    211 - 280
REFMVAFPDPARPPWYACSSAFWAAALLTLSWPLRVLAEYRTAYAHYHVEKLFGLEGPGSASSAGGGLSP    281 - 350
SDELLPPLTHRLPRVNTVDSTELEWHIRSNQQLVPSYSEAVLMDLAGLGTRCGGAGGGYAPSCRYGGVGG    351 - 420
PGAAGVAPYRRSCEHCQRAVSSSSIFSRSALSICASPRAGPGPGGGAGCGGSRFSLGRLYGSRRSCLWRS    421 - 490
RSGSVNEASCPTEQTRLSSQASMGDDEDDDEEEAGPPPPYHDALYFPVLIVHRQEGCLGHSHRPLHRHGS    491 - 560
CVETSL                                                                    561 - 566
//

Text Mined References (7)

PMID Year Title