Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.24
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.400 0.001
posterior fossa group A ependymoma -5.200 0.000
oligodendroglioma -3.200 0.003
glioblastoma -5.600 0.000
osteosarcoma -1.811 0.002
medulloblastoma -5.400 0.000
atypical teratoid / rhabdoid tumor -5.900 0.000
medulloblastoma, large-cell -5.500 0.000
primitive neuroectodermal tumor -3.900 0.000
Atopic dermatitis -1.900 0.000
adrenocortical carcinoma -3.455 0.000
tuberculosis 2.000 0.000
pediatric high grade glioma -4.900 0.000
pilocytic astrocytoma -2.300 0.000
aldosterone-producing adenoma -2.841 0.008
subependymal giant cell astrocytoma -3.384 0.013
ductal carcinoma in situ -1.100 0.003
ovarian cancer -1.200 0.001
psoriasis -1.100 0.000

AA Sequence

MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNF      1 - 70
LNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADY     71 - 140
NLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQL    141 - 210
EDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQL    211 - 280
ENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKT    281 - 350
HPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV    351 - 420
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPV    421 - 490
YIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKC    491 - 560
ETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLIL    561 - 630
TVFVAFCLLVFVLRRNKKPTVKHEGLGNPDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTC    631 - 700
GLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN    701 - 770
SIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI       771 - 837
//

Text Mined References (11)

PMID Year Title
21812955 2011 Serum estradiol levels associated with specific gene expression patterns in normal breast tissue and in breast carcinomas.
20934677 2011 A transcriptional profile of the decidua in preeclampsia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
14550773 2003 Identification and characterization of Slitrk, a novel neuronal transmembrane protein family controlling neurite outgrowth.
More...