Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.24
PubTator Score 2.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.79332308062834E-21
posterior fossa group A ependymoma 1511 6.68357450282102E-19
atypical teratoid / rhabdoid tumor 4369 1.85519961169568E-14
medulloblastoma 1524 3.2424824339601E-10
pediatric high grade glioma 2712 7.89790750306675E-10
glioblastoma 5572 2.04231094518268E-9
medulloblastoma, large-cell 6234 8.79063058077182E-8
tuberculosis 1563 9.93309137398031E-7
Atopic dermatitis 944 4.0034333572729E-5
primitive neuroectodermal tumor 3031 5.02695716974619E-5
pilocytic astrocytoma 3086 9.25723219474468E-5
adrenocortical carcinoma 1427 1.0718134975161E-4
ovarian cancer 8492 0.00100540248532001
astrocytic glioma 2241 0.00119252358980339
osteosarcoma 7933 0.00161518069218839
ductal carcinoma in situ 1745 0.00325923238508474
oligodendroglioma 2849 0.00348325279546208
aldosterone-producing adenoma 664 0.00785038569197258
subependymal giant cell astrocytoma 2287 0.0134256457118736
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.400 0.001
posterior fossa group A ependymoma -5.200 0.000
oligodendroglioma -3.200 0.003
glioblastoma -5.600 0.000
osteosarcoma -1.811 0.002
medulloblastoma -5.400 0.000
atypical teratoid / rhabdoid tumor -5.900 0.000
medulloblastoma, large-cell -5.500 0.000
primitive neuroectodermal tumor -3.900 0.000
Atopic dermatitis -1.900 0.000
adrenocortical carcinoma -3.455 0.000
tuberculosis 2.000 0.000
pediatric high grade glioma -4.900 0.000
pilocytic astrocytoma -2.300 0.000
aldosterone-producing adenoma -2.841 0.008
subependymal giant cell astrocytoma -3.384 0.013
ductal carcinoma in situ -1.100 0.003
ovarian cancer -1.200 0.001
psoriasis -1.100 0.000

Synonym

Accession Q8IW52 Q5JXG3 Q8TCM8 Q96DL3
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNF      1 - 70
LNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADY     71 - 140
NLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQL    141 - 210
EDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQL    211 - 280
ENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKT    281 - 350
HPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV    351 - 420
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPV    421 - 490
YIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKC    491 - 560
ETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLIL    561 - 630
TVFVAFCLLVFVLRRNKKPTVKHEGLGNPDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTC    631 - 700
GLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN    701 - 770
SIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI       771 - 837
//

Text Mined References (11)

PMID Year Title
21812955 2011 Serum estradiol levels associated with specific gene expression patterns in normal breast tissue and in breast carcinomas.
20934677 2011 A transcriptional profile of the decidua in preeclampsia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
14550773 2003 Identification and characterization of Slitrk, a novel neuronal transmembrane protein family controlling neurite outgrowth.
More...