Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.3e-05
ependymoma -1.300 7.9e-11
group 3 medulloblastoma -1.100 4.8e-04
medulloblastoma, large-cell -1.200 1.1e-05
osteosarcoma -1.044 9.2e-03

AA Sequence

MMEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM      1 - 70
GSPVNQQPKKNNVMARTRLVVPNKGYSSLDQSPDEKPLVALDTDSDDDFDMSRYSSSGYSSAEQINQDLN     71 - 140
IQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCCQATSSTACHIQ                             141 - 185
//

Text Mined References (14)

PMID Year Title