Property Summary

Ligand Count 3
NCBI Gene PubMed Count 37
PubMed Score 78.82
PubTator Score 45.30

Knowledge Summary

Patent (9,373)

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 1.2e-02
Disease Target Count Z-score Confidence
Vitamin K deficiency hemorrhagic disease 11 3.288 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.600 1.2e-02

Protein-protein Interaction (5)

Gene RIF (14)

AA Sequence

MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCA      1 - 70
THPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCH     71 - 140
LLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIP    141 - 210
TSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDV    211 - 280
VRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLK    281 - 350
PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ    351 - 420
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ                     421 - 473
//

Text Mined References (45)

PMID Year Title