Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
CILIARY DYSKINESIA, PRIMARY, 17 1 0.0 0.0
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 5.093 2.5

Expression

Gene RIF (2)

AA Sequence

MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT      1 - 70
VPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVG     71 - 140
FGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKEG    141 - 210
LSWEEQGLEEQSGGLQEEERLLQELLELYQVD                                          211 - 242
//

Text Mined References (11)

PMID Year Title