Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.32
PubTator Score 4.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 4.4952743934882E-7
group 4 medulloblastoma 1875 5.25078461625196E-6
primitive neuroectodermal tumor 3031 4.18930664771469E-5
medulloblastoma, large-cell 6234 6.55540754927442E-5
lung cancer 4473 9.14164748107376E-4
gastric cancer 436 0.00433020359882258

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 0.004
malignant mesothelioma 1.900 0.000
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.000
lung cancer 1.800 0.001

Synonym

Accession Q8IW35 B5MDY8 Q8NA71 Q9H5T9 Cep97
Symbols LRRIQ2
2810403B08Rik

Gene

PANTHER Protein Class (1)

  Ortholog (10)

 MGI Term (1)

AA Sequence

MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRL      1 - 70
VRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIG     71 - 140
DLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMA    141 - 210
TPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTL    211 - 280
GLQTAEDAKLEKILSKQRFHQRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNS    281 - 350
WVGINSNDDQLFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVE    351 - 420
LRLQGINLGLEDDGVADESVKGLESQVLDKEEEQPLWAANENSVQMMRSEINTEVNEKAGLLPCPEPTII    421 - 490
SAILKDDNHSLTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMILTQRSVALGQDKVALQKLND    491 - 560
AATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCLTDEIRRLRKERDEERIKKFVQEEAFRFLWN    561 - 630
QVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPD    631 - 700
SGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWNKESSNNEQDNS    701 - 770
LLEQYLTSVQQLEDADERTNFDTETRDSKLHIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSK    771 - 840
LNAEVQGQQPECDSTFQLLHVGVTV                                                 841 - 865
//

Text Mined References (24)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22441691 2012 Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres.
22261722 2012 Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.
21620453 2011 Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
More...