Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.40
PubTator Score 4.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Townes-Brocks syndrome 15 4.269 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.100 4.3e-03
group 4 medulloblastoma 1.500 5.3e-06
lung cancer 1.800 9.1e-04
malignant mesothelioma 1.900 4.5e-07
medulloblastoma, large-cell 1.100 6.6e-05
primitive neuroectodermal tumor 1.100 4.2e-05

AA Sequence

MAVARVDAALPPGEGSVVNWSGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRL      1 - 70
VRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIG     71 - 140
DLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMA    141 - 210
TPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLTSTL    211 - 280
GLQTAEDAKLEKILSKQRFHQRQLMNQSQNEELSPLVPVETRASLIPEHSSPVQDCQISQESEPVIQVNS    281 - 350
WVGINSNDDQLFAVKNNFPASVHTTRYSRNDLHLEDIQTDEDKLNCSLLSSESTFMPVASGLSPLSPTVE    351 - 420
LRLQGINLGLEDDGVADESVKGLESQVLDKEEEQPLWAANENSVQMMRSEINTEVNEKAGLLPCPEPTII    421 - 490
SAILKDDNHSLTFFPESTEQKQSDIKKPENTQPENKETISQATSEKLPMILTQRSVALGQDKVALQKLND    491 - 560
AATKLQACWRGFYARNYNPQAKDVRYEIRLRRMQEHIVCLTDEIRRLRKERDEERIKKFVQEEAFRFLWN    561 - 630
QVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPD    631 - 700
SGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWNKESSNNEQDNS    701 - 770
LLEQYLTSVQQLEDADERTNFDTETRDSKLHIACFPVQLDTLSDGASVDESHGISPPLQGEISQTQENSK    771 - 840
LNAEVQGQQPECDSTFQLLHVGVTV                                                 841 - 865
//

Text Mined References (24)

PMID Year Title