Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
Funding $2,333,036.1
PubMed Score 44.99
PubTator Score 32.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.199 0.000
lung carcinoma -1.600 0.000

Gene RIF (12)

PMID Text
23689425 These data suggest functional requirements for Ku and XRCC4 in APLF-dependent NHEJ and a unique role for Ku as a factor required to facilitate the nuclear retention of APLF.
23178593 APLF promotes the assembly and activity of multi-protein Ku-DNA complexes containing all of the Non-homologous end joining (NHEJ) factors required for DNA ligation.
21885877 Polynucleotide kinase and aprataxin-like forkhead-associated protein (PALF) acts as both a single-stranded DNA endonuclease and a single-stranded DNA 3' exonuclease and can participate in DNA end joining in a biochemical system.
21414327 only a positive association (OR=1.58, 95% CI 1.05-2.46, P=0.027) was obtained for XRCC1 (Arg280His
21211722 The poly(ADP-ribose)-regulated protein APLF as a DNA-damage-specific histone chaperone.
21211721 APLF has a role in chromosomal DNA double-strand break repair.
20098424 The authors present solution structures of the two poly(ADP-ribose)-binding zinc finger modules of aprataxin and PNK-like factor (APLF), revealing a novel type of zinc finger.
18474613 Study concludes that APLF can accumulate at sites of chromosomal damage via zinc finger-mediated binding to poly(ADP-ribose) and is a novel component of poly(ADP-ribose) signaling in mammalian cells.
18172500 interaction of poly(ADP-ribose) with a PBZ motif in two representative human proteins, APLF (aprataxin PNK-like factor) and CHFR (checkpoint protein with FHA and RING domains)
18077224 APLF is an ATM target that is involved in nonhomologous end-joining and facilitates double-strand break repair, likely via interactions with Ku and XRCC4-DNA ligase IV.
More...

AA Sequence

MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTNPCFYQSSEKS      1 - 70
QLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPSEVEMQCTLRNSQVLDEDNILNETPKSPVINLPHET     71 - 140
TGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNV    141 - 210
IQGSGKEEICKDKSQLNTTQQGRRQLISSGSSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLS    211 - 280
NTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSN    281 - 350
PSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE    351 - 420
CPYGPSCYRKNPQHKIEYRHNTLPVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKE    421 - 490
DEEKEDVEELLKEAKRFMKRK                                                     491 - 511
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23689425 2013 Identification and functional characterization of a Ku-binding motif in aprataxin polynucleotide kinase/phosphatase-like factor (APLF).
23178593 2013 APLF promotes the assembly and activity of non-homologous end joining protein complexes.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21885877 2011 Polynucleotide kinase and aprataxin-like forkhead-associated protein (PALF) acts as both a single-stranded DNA endonuclease and a single-stranded DNA 3' exonuclease and can participate in DNA end joining in a biochemical system.
21414327 2011 Association studies of OGG1, XRCC1, XRCC2 and XRCC3 polymorphisms with differentiated thyroid cancer.
21211722 2011 DNA repair factor APLF is a histone chaperone.
21211721 2011 PARP-3 and APLF function together to accelerate nonhomologous end-joining.
20439749 2010 Structure and identification of ADP-ribose recognition motifs of APLF and role in the DNA damage response.
20098424 2010 Solution structures of the two PBZ domains from human APLF and their interaction with poly(ADP-ribose).
More...