Property Summary

NCBI Gene PubMed Count 21
PubMed Score 44.99
PubTator Score 32.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.19251472391969E-27
osteosarcoma 7933 2.8838122458491E-8
Disease Target Count Z-score Confidence
Inhalation anthrax 5 4.165 2.1
Junctional epidermolysis bullosa 9 3.183 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.199 0.000
lung carcinoma -1.600 0.000

Synonym

Accession Q8IW19 A8K476 Q53P47 Q53PB9 Q53QU0
Symbols APFL
PALF
Xip1
ZCCHH1
C2orf13

Gene

PDB

5E50   2KQB   2KQC   2KQD   2KQE   2KUO  

  Ortholog (7)

Gene RIF (12)

PMID Text
23689425 These data suggest functional requirements for Ku and XRCC4 in APLF-dependent NHEJ and a unique role for Ku as a factor required to facilitate the nuclear retention of APLF.
23178593 APLF promotes the assembly and activity of multi-protein Ku-DNA complexes containing all of the Non-homologous end joining (NHEJ) factors required for DNA ligation.
21885877 Polynucleotide kinase and aprataxin-like forkhead-associated protein (PALF) acts as both a single-stranded DNA endonuclease and a single-stranded DNA 3' exonuclease and can participate in DNA end joining in a biochemical system.
21414327 only a positive association (OR=1.58, 95% CI 1.05-2.46, P=0.027) was obtained for XRCC1 (Arg280His
21211722 The poly(ADP-ribose)-regulated protein APLF as a DNA-damage-specific histone chaperone.
21211721 APLF has a role in chromosomal DNA double-strand break repair.
20098424 The authors present solution structures of the two poly(ADP-ribose)-binding zinc finger modules of aprataxin and PNK-like factor (APLF), revealing a novel type of zinc finger.
18474613 Study concludes that APLF can accumulate at sites of chromosomal damage via zinc finger-mediated binding to poly(ADP-ribose) and is a novel component of poly(ADP-ribose) signaling in mammalian cells.
18172500 interaction of poly(ADP-ribose) with a PBZ motif in two representative human proteins, APLF (aprataxin PNK-like factor) and CHFR (checkpoint protein with FHA and RING domains)
18077224 APLF is an ATM target that is involved in nonhomologous end-joining and facilitates double-strand break repair, likely via interactions with Ku and XRCC4-DNA ligase IV.
More...

AA Sequence

MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTNPCFYQSSEKS      1 - 70
QLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPSEVEMQCTLRNSQVLDEDNILNETPKSPVINLPHET     71 - 140
TGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNV    141 - 210
IQGSGKEEICKDKSQLNTTQQGRRQLISSGSSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLS    211 - 280
NTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSN    281 - 350
PSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE    351 - 420
CPYGPSCYRKNPQHKIEYRHNTLPVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKE    421 - 490
DEEKEDVEELLKEAKRFMKRK                                                     491 - 511
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23689425 2013 Identification and functional characterization of a Ku-binding motif in aprataxin polynucleotide kinase/phosphatase-like factor (APLF).
23178593 2013 APLF promotes the assembly and activity of non-homologous end joining protein complexes.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21885877 2011 Polynucleotide kinase and aprataxin-like forkhead-associated protein (PALF) acts as both a single-stranded DNA endonuclease and a single-stranded DNA 3' exonuclease and can participate in DNA end joining in a biochemical system.
21414327 2011 Association studies of OGG1, XRCC1, XRCC2 and XRCC3 polymorphisms with differentiated thyroid cancer.
21211722 2011 DNA repair factor APLF is a histone chaperone.
21211721 2011 PARP-3 and APLF function together to accelerate nonhomologous end-joining.
20439749 2010 Structure and identification of ADP-ribose recognition motifs of APLF and role in the DNA damage response.
20098424 2010 Solution structures of the two PBZ domains from human APLF and their interaction with poly(ADP-ribose).
More...