Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.800 1.1e-04
Astrocytoma, Pilocytic -1.900 2.4e-08
atypical teratoid / rhabdoid tumor -2.000 1.6e-10
glioblastoma -1.900 1.6e-12
group 3 medulloblastoma -1.900 1.5e-03
medulloblastoma, large-cell -1.700 1.8e-04
psoriasis -1.500 1.1e-13

Gene RIF (2)

AA Sequence

MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRAVTQSAPEQGSFHPHHLSH      1 - 70
HHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAE     71 - 140
IVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFTYRLELNRNHR    141 - 210
RLKWEATPRSVLECVDSVITDGDCLVLNTSLAQLFSDNGSLAIGIAITATEVLPSEAEM               211 - 269
//

Text Mined References (8)

PMID Year Title