Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.04
PubTator Score 0.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.503 0.000
cystic fibrosis 1.307 0.000
medulloblastoma, large-cell -1.600 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.004
lung cancer -1.500 0.000
sonic hedgehog group medulloblastoma 1.300 0.000
invasive ductal carcinoma -1.500 0.002
ovarian cancer -1.200 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLLALAAAALLARAPAPEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAVRWFFAHSFDS      1 - 70
QEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPSDQGHYVCRVQEISRHRNKWT     71 - 140
AWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVYAVLVCCVGILSILLFMLVIVWQSVFNKRKS    141 - 210
RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLP    211 - 280
KIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFEENKL                                  281 - 320
//

Text Mined References (10)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
21294900 2011 A genome-wide association study of serum uric acid in African Americans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.