Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.04
PubTator Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
cystic fibrosis 1.307 1.6e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.6e-03
invasive ductal carcinoma -1.400 4.2e-04
lung cancer -1.500 3.0e-04
medulloblastoma, large-cell 1.200 2.4e-04
osteosarcoma 1.503 1.8e-05
ovarian cancer 1.100 1.0e-10
sonic hedgehog group medulloblastoma 1.100 2.1e-02

Gene RIF (2)

AA Sequence

MRLLALAAAALLARAPAPEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAVRWFFAHSFDS      1 - 70
QEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPSDQGHYVCRVQEISRHRNKWT     71 - 140
AWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVYAVLVCCVGILSILLFMLVIVWQSVFNKRKS    141 - 210
RVRHYLVKCPQNSSGETVTSVTSLAPLQPKKGKRQKEKPDIPPAVPAKAPIAPTFHKPKLLKPQRKVTLP    211 - 280
KIAEENLTYAELELIKPHRAAKGAPTSTVYAQILFEENKL                                  281 - 320
//

Text Mined References (10)

PMID Year Title