Property Summary

NCBI Gene PubMed Count 5
Grant Count 37
R01 Count 9
Funding $5,260,074.33
PubMed Score 513.76
PubTator Score 45.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.013
gastric carcinoma -1.700 0.011
ulcerative colitis -1.900 0.000
ovarian cancer 1.400 0.000

AA Sequence

MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYRHRPLP      1 - 70
ETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL                                71 - 113
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.