Property Summary

NCBI Gene PubMed Count 5
PubMed Score 513.76
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.92214452523688E-11
ulcerative colitis 2087 1.32917300568835E-5
gastric carcinoma 832 0.0112523882782761
non primary Sjogren syndrome sicca 840 0.0134803627392092
Disease Target Count Z-score Confidence
Prostate calculus 3 4.395 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.013
gastric carcinoma -1.700 0.011
ulcerative colitis -1.900 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q8IVY1 D3DPX2 TEMP
Symbols TEMP

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

AA Sequence

MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIALAAKCHLCRRYHASYRHRPLP      1 - 70
ETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHFSL                                71 - 113
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.