Property Summary

NCBI Gene PubMed Count 10
PubMed Score 26.42
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis 1.383 2.3e-03
atypical teratoid/rhabdoid tumor -1.200 4.2e-06
cystic fibrosis 1.100 3.4e-04
ependymoma -1.200 2.6e-08
interstitial cystitis 1.100 2.6e-04
lung adenocarcinoma -2.100 2.4e-06
lung carcinoma -1.100 5.4e-13
non-small cell lung cancer -1.343 2.6e-15
pediatric high grade glioma -1.100 9.3e-06
spina bifida -1.663 3.9e-02

Gene RIF (6)

AA Sequence

MMCLECASAAAGGAEEEEADAERRRRRRGAQRGAGGSGCCGARGAGGAGVSAAGDEVQTLSGSVRRAPTG      1 - 70
PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRYTVAGVLLDIQQHFGVKDRGA     71 - 140
GLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSAVTFSSSFIPQQYFWLLVLSRGLVGIGEASY    141 - 210
STIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILIL    211 - 280
VPATKRGHADQLGDQLKARTSWLRDMKALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTA    281 - 350
ETCNSPPCGAKDSLIFGAITCFTGFLGVVTGAGATRWCRLKTQRADPLVCAVGMLGSAIFICLIFVAAKS    351 - 420
SIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLLGDAGSPYLIGFISDLIRQST    421 - 490
KDSPLWEFLSLGYALMLCPFVVVLGGMFFLATALFFVSDRARAEQQVNQLAMPPASVKV               491 - 549
//

Text Mined References (11)

PMID Year Title