Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $431,488.3
PubMed Score 23.32
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma -1.200 0.000
non-small cell lung cancer -1.343 0.000
active ulcerative colitis 1.383 0.002
interstitial cystitis 1.100 0.000
cystic fibrosis 1.200 0.000
pediatric high grade glioma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
lung adenocarcinoma -2.100 0.000
lung carcinoma -1.100 0.000
spina bifida -1.663 0.039

Synonym

Accession Q8IVW8 B9A1T3
Symbols

Gene

PANTHER Protein Class (1)

Pathway (1)

Gene RIF (4)

PMID Text
25356849 mammals. These findings indicate that Spns2 is required for normal maintenance of the endocochlear potential and hence for normal auditory function, and support a role for S1P signalling in hearing.
25330231 Spns2 plays key roles in regulating the cellular functions in non-small cell lung cancer (NSCLC) cells
23180825 Spns2 is an S1P transporter in vivo that plays a role in regulation not only of blood S1P but also lymph node and lymph S1P levels and consequently influences lymphocyte trafficking and lymphatic vessel network organization.
21084291 The sphingosine 1-phosphate transporter, SPNS2, functions as a transporter of the phosphorylated form of the immunomodulating agent FTY720.

AA Sequence

MMCLECASAAAGGAEEEEADAERRRRRRGAQRGAGGSGCCGARGAGGAGVSAAGDEVQTLSGSVRRAPTG      1 - 70
PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRYTVAGVLLDIQQHFGVKDRGA     71 - 140
GLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSAVTFSSSFIPQQYFWLLVLSRGLVGIGEASY    141 - 210
STIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILIL    211 - 280
VPATKRGHADQLGDQLKARTSWLRDMKALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTA    281 - 350
ETCNSPPCGAKDSLIFGAITCFTGFLGVVTGAGATRWCRLKTQRADPLVCAVGMLGSAIFICLIFVAAKS    351 - 420
SIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLLGDAGSPYLIGFISDLIRQST    421 - 490
KDSPLWEFLSLGYALMLCPFVVVLGGMFFLATALFFVSDRARAEQQVNQLAMPPASVKV               491 - 549
//

Text Mined References (9)

PMID Year Title
26324848 2015 Spinster 2, a sphingosine-1-phosphate transporter, plays a critical role in inflammatory and autoimmune diseases.
25356849 2014 Spinster homolog 2 (spns2) deficiency causes early onset progressive hearing loss.
25330231 2014 Critical role of Spns2, a sphingosine-1-phosphate transporter, in lung cancer cell survival and migration.
23180825 2013 Spns2, a transporter of phosphorylated sphingoid bases, regulates their blood and lymph levels, and the lymphatic network.
21084291 2011 The sphingosine 1-phosphate transporter, SPNS2, functions as a transporter of the phosphorylated form of the immunomodulating agent FTY720.
19074308 2009 The sphingolipid transporter spns2 functions in migration of zebrafish myocardial precursors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815463 2003 HSpin1, a transmembrane protein interacting with Bcl-2/Bcl-xL, induces a caspase-independent autophagic cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.