Property Summary

NCBI Gene PubMed Count 14
Grant Count 27
R01 Count 22
Funding $3,644,345
PubMed Score 12.76
PubTator Score 34.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
osteosarcoma -1.757 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.500 0.000
diabetes mellitus 1.200 0.005
acute myeloid leukemia 1.300 0.018

Gene RIF (9)

PMID Text
26519881 Although ARID3B and ARID3A share overlapping functions, ARID3B play a key role in the expression of pro-apoptotic p53-target genes and apoptosis.
25327563 ARID3B boosts production CD133+ tumor stem cells and increases ovarian cancer progression in vivo.
25120063 Data report a positive correlation between ER positivity and nuclear ARID3B expression in primary breast cancers, along with a negative correlation with the ERBB2 status.
24704276 The different patterns of ARID3B in normal tissues translate into different roles for ARID3B in carcinomas.
22860069 ARID3B Fl induces death receptor mediated apoptosis while the novel splice form ARID3B Sh does not induce cell death
22751132 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22307404 Among possible numerous targets of miR-125b, we showed ARID3B (AT-rich interactive domain 3B) to be a novel target with roles in cell motility in breast cancer cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19881956 We identify AT-rich interactive domain 3B (ARID3B) as a target of miR-125a and demonstrate that ARID3B is overexpressed in human ovarian cancer

AA Sequence

MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQPTLLSATAGRPSGSTPLGPLA      1 - 70
RVPPTAAVAQVFERGNMNSEPEEEDGGLEDEDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNL     71 - 140
LPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDEQLKQNGGLAWSDDADGGRGREISRDFAKLY    141 - 210
ELDGDPERKEFLDDLFVFMQKRGTPINRIPIMAKQILDLYMLYKLVTEKGGLVEIINKKIWREITKGLNL    211 - 280
PTSITSAAFTLRTQYMKYLYAYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAG    281 - 350
APALLSPPKIRFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVPNRLAVPVTLASQQAGTRTAA    351 - 420
LEQLRERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRAEDRAEASAAALNLTTS    421 - 490
SIGSINMSVDIDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWS    491 - 560
L//

Text Mined References (24)

PMID Year Title
26519881 2015 Critical role of ARID3B in the expression of pro-apoptotic p53-target genes and apoptosis.
25327563 2014 ARID3B increases ovarian tumor burden and is associated with a cancer stem cell gene signature.
25120063 2014 ARID3B expression in primary breast cancers and breast cancer-derived cell lines.
24704276 2014 Differential expression of ARID3B in normal adult tissue and carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22860069 2012 ARID3B induces tumor necrosis factor alpha mediated apoptosis while a novel ARID3B splice form does not induce cell death.
22751132 2013 Epigenetic regulation of the neuroblastoma genes, Arid3b and Mycn.
22307404 2012 miR-125b targets ARID3B in breast cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...