Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.96
PubTator Score 6.19

Knowledge Summary

Patent (2,118)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 5.24548822511213E-9
osteosarcoma 7933 2.76663908090644E-4
Disease Target Count Z-score Confidence
Meckel syndrome 48 3.64 1.8
Joubert syndrome 62 3.321 1.7
Nephronophthisis 74 3.091 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.077 0.000
ovarian cancer 1.500 0.000

Synonym

Accession Q8IVW4 D3DQA0 D3DQA1 Q9P114
Symbols NKIAMRE

Gene

PDB

3ZDU  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

 Collection (1)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18412109 data suggest that the CDKL3 gene is a strong candidate for nonsyndromal autosomal dominant mild mental retardation
17945021 cdkl3 transfected in anchorage-independent (suspension) HeLa cells overexpressed relative to attached cells and lead to elevated proliferation and faster transition G0/G1 phases to S phase relative to controls. Same in two HEK-293 and a CHO cell lines.
12927787 NKIAMRE is a member of a conserved family of kinases with homology to both MAP kinases and cyclin-dependent kinases

AA Sequence

MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFR      1 - 70
QKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITK     71 - 140
LCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLL    141 - 210
HKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDL    211 - 280
LHHEYFTRDGFIEKFMPELKAKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKE    281 - 350
KKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE    351 - 420
NPHCGGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVMPNSRQEDPGPIQSQME    421 - 490
KGIFNERTGHSDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGMEVKQIKMLKRESKKTESSKIP    491 - 560
TLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW                                          561 - 592
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18412109 2008 Inactivation of the CDKL3 gene at 5q31.1 by a balanced t(X;5) translocation associated with nonspecific mild mental retardation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17945021 2007 Enhancement of cell proliferation in various mammalian cell lines by gene insertion of a cyclin-dependent kinase homolog.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12927787 2003 NKIAMRE, a novel conserved CDC2-related kinase with features of both mitogen-activated protein kinases and cyclin-dependent kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...