Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.7463838819397E-5
ovarian cancer 8492 4.98462673067488E-5
cystic fibrosis 1670 1.13753284468652E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00126964301133504
Disease Target Count Z-score Confidence
Dyslexia 36 3.926 2.0
progressive supranuclear palsy 674 3.48 1.7


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.592 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.001
cystic fibrosis -1.100 0.000
ovarian cancer -1.100 0.000


Accession Q8IVW1 B0AZR6 Q59FW5 Q8N6E2 Q8TD73 Q8WW54 Q9NZD5 Q9P158
Symbols ARF1P2


Pathway (1)

AA Sequence

ILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVK                                     141 - 177

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.