Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.100 1.1e-04
intraductal papillary-mucinous adenoma (... 1.100 1.3e-03
osteosarcoma -2.592 1.7e-05
ovarian cancer -1.100 5.0e-05

AA Sequence

MGNIFEKLFKSLLGKKKMRILILSLDTAGKTTILYKLKLGETVPAVPTVGFCVETVEYKNNTFAVWDVGS      1 - 70
HFKIRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDS     71 - 140
ILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVK                                     141 - 177
//

Text Mined References (4)

PMID Year Title