Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.87688843712166E-8
pilocytic astrocytoma 3086 1.08573063110944E-7
group 4 medulloblastoma 1875 4.18208743032592E-7
posterior fossa group A ependymoma 1511 7.96004533114627E-7
medulloblastoma, large-cell 6234 9.92175762015026E-5
oligodendroglioma 2849 0.00119220031566187
astrocytic glioma 2241 0.00171408594740404
subependymal giant cell astrocytoma 2287 0.0367453060833676
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0

Expression

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAA      1 - 70
VWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCAL     71 - 140
EPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA      141 - 208
//

Text Mined References (7)

PMID Year Title
17606467 2007 A novel family of transmembrane proteins interacting with beta subunits of the Na,K-ATPase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.