Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 2.700 1.7e-03
Astrocytoma, Pilocytic 1.500 2.1e-07
atypical teratoid / rhabdoid tumor -2.500 1.9e-08
ependymoma 1.300 1.0e-03
group 3 medulloblastoma -1.800 5.5e-04
medulloblastoma, large-cell -1.700 3.2e-03
oligodendroglioma 2.500 1.2e-03
subependymal giant cell astrocytoma -1.378 3.7e-02

AA Sequence

MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAA      1 - 70
VWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCAL     71 - 140
EPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA      141 - 208
//

Text Mined References (7)

PMID Year Title