Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
R01 Count 2
Funding $476,540
PubMed Score 6.74
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.005
intraductal papillary-mucinous neoplasm ... -1.100 0.035
lung cancer 1.100 0.004
spina bifida -1.058 0.039
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -1.600 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q8IVV7 Q8TEB5 Q9BW50
Symbols VID24
C17orf39

Gene

 Grant Application (2)

AA Sequence

MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVP      1 - 70
LPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYD     71 - 140
VEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQ    141 - 210
YAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEW    211 - 280
YQSLNLTHVPEHSAPIYEFR                                                      281 - 300
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11840190 2001 Genomic organisation of the approximately 1.5 Mb Smith-Magenis syndrome critical interval: transcription map, genomic contig, and candidate gene analysis.