Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.59
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hepatomegaly 285 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 1.5e-09
non-small cell lung carcinoma 317 2.3e-08
lung carcinoma 2843 6.7e-08
pituitary cancer 1972 1.3e-05
ependymoma 4679 1.1e-03
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 1.1e-03
lung adenocarcinoma -1.700 1.5e-09
lung carcinoma -2.100 6.7e-08
non-small cell lung carcinoma -1.200 2.3e-08
pituitary cancer 1.400 1.3e-05

Synonym

Accession Q8IVU9 Q5T1B8
Symbols bA63A2.1
C10orf107

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLK      1 - 70
ISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLD     71 - 140
QEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA      141 - 208
//

Text Mined References (14)

PMID Year Title