Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.59
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 2.400 0.000
lung adenocarcinoma -1.700 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma -1.200 0.000
pituitary cancer 1.400 0.000

Synonym

Accession Q8IVU9 Q5T1B8
Symbols bA63A2.1

Gene

 Compartment GO Term (0)

Gene RIF (6)

PMID Text
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20542020 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLK      1 - 70
ISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLD     71 - 140
QEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA      141 - 208
//

Text Mined References (13)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21045733 2011 Discovery and replication of novel blood pressure genetic loci in the Women's Genome Health Study.
20852445 2011 Common variants in or near FGF5, CYP17A1 and MTHFR genes are associated with blood pressure and hypertension in Chinese Hans.
20542020 2010 Confirmation of top polymorphisms in hypertension genome wide association study among Han Chinese.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...