Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.16
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.84490354190406E-10
osteosarcoma 7933 2.68924662216343E-6
medulloblastoma, large-cell 6234 6.58379881409956E-4
primitive neuroectodermal tumor 3031 0.00114495284693353

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.887 0.000
group 3 medulloblastoma 3.200 0.000
medulloblastoma, large-cell 1.900 0.001
primitive neuroectodermal tumor 2.600 0.001

Synonym

Accession Q8IVU1 O95215
Symbols PUNC
HsT18880

Gene

  Ortholog (10)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVQRAASPRRPPAPLWPRLLLPLLLLLLPAPSEGLGHSAELAFAVEPSDDVAVPGQPIVLDCRVEGTPP      1 - 70
VRITWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGSPSDEGDYECVAQNRFGLVVSRKARIQAATMSD     71 - 140
FHVHPQATVGEEGGVARFQCQIHGLPKPLITWEKNRVPIDTDNERYTLLPKGVLQITGLRAEDGGIFHCV    141 - 210
ASNIASIRISHGARLTVSGSGSGAYKEPAILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIG    211 - 280
VEGIQVLGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFT    281 - 350
CQAQGEPPPHVTWLKNGQVLGPGGHVRLKNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWA    351 - 420
EGLPGPPRNVRAVSVSSTEVRVSWSEPLANTKEIIGYVLHIRKAADPPELEYQEAVSKSTFQHLVSDLEP    421 - 490
STAYSFYIKAYTPRGASSASVPTLASTLGEAPAPPPLSVRVLGSSSLQLLWEPWPRLAQHEGGFKLFYRP    491 - 560
ASKTSFTGPILLPGTVSSYNLSQLDPTAVYEVKLLAYNQHGDGNATVRFVSLRGASERTALSPPCDCRKE    561 - 630
EAANQTSTTGIVIGIHIGVTCIIFCVLFLLFGQRGRVLLCKDVENQLSPPQGPRSQRDPGILALNGARRG    631 - 700
QRGQLGRDEKRVDMKELEQLFPPASAAGQPDPRPTQDPAAPAPCEETQLSVLPLQGCGLMEGKTTEAKTT    701 - 770
EATAPCAGLAAAPPPPDGGPGLLSEGQASRPAAARVTQPAHSEQ                              771 - 814
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
9922388 1999 Genomic structure and chromosomal localization of the mouse gene Punc.