Property Summary

NCBI Gene PubMed Count 36
PubMed Score 141.14
PubTator Score 100.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Crohn Disease 97
Disease Target Count P-value
ovarian cancer 8492 1.11208473733025E-6
interstitial cystitis 2299 1.2736559903623E-4
primary pancreatic ductal adenocarcinoma 1271 0.00155838663031755
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00166342741786299
osteosarcoma 7933 0.00206223450896653
pancreatic cancer 2300 0.00665240584943747
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00875686199440865
active ulcerative colitis 477 0.0186542189023254
gastric carcinoma 832 0.0353049285438344
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0462973150281407
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

Synonym

Accession Q8IVT5 F8WEA9 H7BYU0 Q13476
Symbols KSR
RSU2

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (23)

PMID Text
25962735 the relative mRNA copy values of KSR1, ERK1 and ERK2 in the cancer tissues were 2.43 +/- 0.49, 2.10 +/- 0.44 and 3.65 +/- 0.94..EGb 761 enhanced the chemotherapy sensitivity through suppression of the KSR1-mediated ERK1/2 pathway in gastric cancer
25608512 KSR1 is coordinately regulated with Notch signaling and oxidative phosphorylation in papillary thyroid cancer.
25287073 KSR1 rs2241906 variants may predict survival in patients with advanced ERalpha+ BC treated with adjuvant TAM.
25002533 Data show that caveolin-1 is necessary for optimal KSR1-dependent ERK activation by growth factors and oncogenic Ras.
24909178 KSR1 stabilizes BRCA1 by reducing BRCA1 ubiquitination, inhibits tumor growth through BRCA1, and regulates BRCA1 stability via elevated BARD1 abundance and increased BRCA1-BARD1 interaction
24129246 Our findings integrate KSR1 into a network involving DBC1 and SIRT1, which results in the regulation of p53 acetylation and its transcriptional activity.
24095280 Data indicate that phosphorylation of BRAF by AMPK disrupts its association with KSR1.
23416464 Elevated levels of phosphorylated KSR were detected in the nuclear fractions.
23250398 the atypical C1 domain, the CC-SAM domain is required to target KSR-1 to the plasma membrane.
22752157 VRK2A can form a high molecular size complex with both MEK1 and KSR1; the KSR1 complex assembled and retained by VRK2A in the endoplasmic reticulum can have a modulatory effect on the signal mediated by MAPK,locally affecting the magnitude of its responses
More...

AA Sequence

MDRAALRAAAMGEKKEGGGGGDAAAAEGGAGAAASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQ      1 - 70
QEIRTLEAKLVRYICKQRQCKLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNE     71 - 140
AKVKETLRRCGASGDECGRLQYALTCLRKVTGLGGEHKEDSSWSSLDARRESGSGPSTDTLSAASLPWPP    141 - 210
GSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRH    211 - 280
TKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMVRRDIGLSVTHRF    281 - 350
STKSWLSQVCHVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAE    351 - 420
PHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPA    421 - 490
AYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAE    491 - 560
AEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRG    561 - 630
RWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRD    631 - 700
PKTSLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGVVREGRRENQLK    701 - 770
LSHDWLCYLAPEIVREMTPGKDEDQLPFSKAADVYAFGTVWYELQARDWPLKNQAAEASIWQIGSGEGMK    771 - 840
RVLTSVSLGKEVSEILSACWAFDLQERPSFSLLMDMLEKLPKLNRRLSHPGHFWKSADINSSKVVPRFER    841 - 910
FGLGVLESSNPKM                                                             911 - 923
//

Text Mined References (47)

PMID Year Title
25962735 2015 Ginkgo biloba extract enhances chemotherapy sensitivity and reverses chemoresistance through suppression of the KSR1-mediated ERK1/2 pathway in gastric cancer cells.
25608512 2015 KSR1 is coordinately regulated with Notch signaling and oxidative phosphorylation in thyroid cancer.
25287073 2015 Genetic variants of kinase suppressors of Ras (KSR1) to predict survival in patients with ER?-positive advanced breast cancer.
25002533 2014 Caveolin-1 is required for kinase suppressor of Ras 1 (KSR1)-mediated extracellular signal-regulated kinase 1/2 activation, H-RasV12-induced senescence, and transformation.
24909178 2015 KSR1 regulates BRCA1 degradation and inhibits breast cancer growth.
24129246 2013 SILAC-based phosphoproteomics reveals an inhibitory role of KSR1 in p53 transcriptional activity via modulation of DBC1.
24095280 2013 Phosphorylation of BRAF by AMPK impairs BRAF-KSR1 association and cell proliferation.
23416464 2013 RGS19 inhibits Ras signaling through Nm23H1/2-mediated phosphorylation of the kinase suppressor of Ras.
23250398 2012 A CC-SAM, for coiled coil-sterile ? motif, domain targets the scaffold KSR-1 to specific sites in the plasma membrane.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...