Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.93
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 3.500 0.000
Barrett's esophagus 1.400 0.042
esophageal adenocarcinoma 1.600 0.019
osteosarcoma 1.668 0.000
lung cancer 1.700 0.001
psoriasis -1.200 0.000

Synonym

Accession Q8IVT2
Symbols MISP1
C19orf21

Gene

Gene RIF (4)

PMID Text
24475924 MISP is an effector for cell type-specific actin reorganization with its direct actin-binding properties and provides a novel model of cell morphology regulation by a non-ubiquitous single actin-bundling protein.
24475924 Bundles F-actin and balances stress fiber-filopodial formation
23574715 MISP links microtubules to the actin cytoskeleton and focal adhesions in order to properly position the mitotic spindle.
23509069 Plk1 phosphorylates MISP, thus stabilizing cortical and astral microtubule attachments required for proper mitotic spindle positioning.

AA Sequence

MDRVTRYPILGIPQAHRGTGLVLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQGVQRQGVSYSV      1 - 70
HAYTGQPSPRGLHSENREDEGWQVYRLGARDAHQGRPTWALRPEDGEDKEMKTYRLDAGDADPRRLCDLE     71 - 140
RERWAVIQGQAVRKSSTVATLQGTPDHGDPRTPGPPRSTPLEENVVDREQIDFLAARQQFLSLEQANKGA    141 - 210
PHSSPARGTPAGTTPGASQAPKAFNKPHLANGHVVPIKPQVKGVVREENKVRAVPTWASVQVVDDPGSLA    211 - 280
SVESPGTPKETPIEREIRLAQEREADLREQRGLRQATDHQELVEIPTRPLLTKLSLITAPRRERGRPSLY    281 - 350
VQRDIVQETQREEDHRREGLHVGRASTPDWVSEGPQPGLRRALSSDSILSPAPDARAADPAPEVRKVNRI    351 - 420
PPDAYQPYLSPGTPQLEFSAFGAFGKPSSLSTAEAKAATSPKATMSPRHLSESSGKPLSTKQEASKPPRG    421 - 490
CPQANRGVVRWEYFRLRPLRFRAPDEPQQAQVPHVWGWEVAGAPALRLQKSQSSDLLERERESVLRREQE    491 - 560
VAEERRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPG    561 - 630
QRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD                         631 - 679
//

Text Mined References (14)

PMID Year Title
24475924 2014 Caprice/MISP is a novel F-actin bundling protein critical for actin-based cytoskeletal reorganizations.
23574715 2013 The novel actin/focal adhesion-associated protein MISP is involved in mitotic spindle positioning in human cells.
23509069 2013 MISP is a novel Plk1 substrate required for proper spindle orientation and mitotic progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19170763 2009 Proteomic and targeted analytical identification of BXDC1 and EBNA1BP2 as dynamic scaffold proteins in the nucleolus.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...