Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.37
PubTator Score 7.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.466 0.000
pancreatic ductal adenocarcinoma liver m... -1.391 0.001

Synonym

Accession Q8IVS8 Q0P630 Q2EZ43 Q6Y2K6 Q7Z6G5 Q86YR8 Q8TED2 Q8WTY2
Symbols HBEBP2
HBEBP4
HBeAgBP4A

Gene

Gene RIF (3)

PMID Text
20949620 Mutations in the GLYCTK gene is the cause of D-glycerate kinase deficiency and D-glyceric aciduria.
20800603 Observational study of gene-disease association. (HuGE Navigator)
16753811 Identification of two variants of the human glycerate kinase gene-Glycerate kinase 1 (GLYCTK1), longer variant, and Glycerate kinase 2 (GLYCTK2), shorter variant.

AA Sequence

MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV      1 - 70
RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE     71 - 140
GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ    141 - 210
ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL    211 - 280
PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL    281 - 350
LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG    351 - 420
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH    421 - 490
TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR                                         491 - 523
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20949620 2010 D-glyceric aciduria is caused by genetic deficiency of D-glycerate kinase (GLYCTK).
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16753811 2006 Isolation and characterization of the human D-glyceric acidemia related glycerate kinase gene GLYCTK1 and its alternatively splicing variant GLYCTK2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...