Property Summary

NCBI Gene PubMed Count 12
Grant Count 487
R01 Count 180
Funding $132,506,995.99
PubMed Score 82.44
PubTator Score 194.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 0.000
Multiple Sclerosis -1.400 0.003
non-inflammatory breast cancer -2.700 0.003
ovarian cancer 1.400 0.000

Synonym

Accession Q8IVS2 B0QY72 O95510 O95511 MCT
Symbols MT
MCT
fabD
NET62
FASN2C

Gene

PANTHER Protein Class (2)

PDB

2C2N  

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20564319 Meta-analysis of gene-disease association. (HuGE Navigator)
19767753 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQ      1 - 70
GSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQP     71 - 140
SVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLE    141 - 210
AREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEP    211 - 280
LTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGP    281 - 350
GRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR                                  351 - 390
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20564319 2010 Prostate cancer risk-associated variants reported from genome-wide association studies: meta-analysis and their contribution to genetic Variation.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16434556 2006 Exercise training decreases the concentration of malonyl-CoA and increases the expression and activity of malonyl-CoA decarboxylase in human muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...