Property Summary

NCBI Gene PubMed Count 12
PubMed Score 89.77
PubTator Score 194.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
ovarian cancer 8520 1.3e-05
psoriasis 6694 1.0e-04
inflammatory breast cancer 286 2.3e-03
Multiple Sclerosis 540 3.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Otitis Media 52 4.355 2.2
Leptospirosis 18 3.288 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
inflammatory breast cancer -2.300 2.3e-03
Multiple Sclerosis -1.400 3.1e-03
ovarian cancer 1.400 1.3e-05
psoriasis 1.600 1.0e-04

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQ      1 - 70
GSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQP     71 - 140
SVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLE    141 - 210
AREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEP    211 - 280
LTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGP    281 - 350
GRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR                                  351 - 390
//

Text Mined References (16)

PMID Year Title