Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.34
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 9.9e-03
atypical teratoid / rhabdoid tumor -1.600 1.9e-07
ependymoma -1.100 1.7e-04
glioblastoma -1.100 1.3e-02
intraductal papillary-mucinous adenoma (... 1.500 4.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
medulloblastoma -1.200 1.5e-03
medulloblastoma, large-cell -1.800 1.2e-04
osteosarcoma -2.071 6.7e-05
ovarian cancer 1.400 2.3e-03
primitive neuroectodermal tumor -1.100 1.6e-02
psoriasis 1.800 4.2e-42

Gene RIF (2)

AA Sequence

MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASIT      1 - 70
DPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCF     71 - 140
YTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTT    141 - 210
SIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV                   211 - 265
//

Text Mined References (15)

PMID Year Title