Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 4
Funding $527,058.3
PubMed Score 3.64
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (2)

PMID Text
22496122 We show that knockdown of ZDHHC21 leads to reduced levels of platelet endothelial cell adhesion molecule-1 at the cell surface.
22031296 the DHHC-7 and -21 proteins are novel targets to selectively inhibit membrane sex steroid receptor localization and function

AA Sequence

MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASIT      1 - 70
DPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCF     71 - 140
YTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTT    141 - 210
SIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV                   211 - 265
//

Text Mined References (13)

PMID Year Title
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22496122 2012 Endothelial cell palmitoylproteomic identifies novel lipid-modified targets and potential substrates for protein acyl transferases.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22031296 2012 DHHC-7 and -21 are palmitoylacyltransferases for sex steroid receptors.
19956733 2009 Palmitoylation regulates epidermal homeostasis and hair follicle differentiation.
19754311 2009 Genomewide association study of a rapid progression cohort identifies new susceptibility alleles for AIDS (ANRS Genomewide Association Study 03).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...