Property Summary

NCBI Gene PubMed Count 7
PubMed Score 80.83
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (1)

PMID Text
17519359 CSRP3, MUSTN1, SIX1, and FBXO32 expression changes in response to lengthening and shortening contractions in human muscle

AA Sequence

MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE      1 - 70
KPKAGPTKSVFG                                                               71 - 82
//

Text Mined References (9)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
17519359 2007 Gene expression responses over 24 h to lengthening and shortening contractions in human muscle: major changes in CSRP3, MUSTN1, SIX1, and FBXO32.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718386 2004 Molecular cloning and characterization of Mustang, a novel nuclear protein expressed during skeletal development and regeneration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.