Property Summary

NCBI Gene PubMed Count 16
Grant Count 16
R01 Count 13
Funding $985,532.73
PubMed Score 27.77
PubTator Score 9.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hyperuricemia 35 3.25 1.6
psoriasis 6,685

Expression

Gene RIF (9)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19371258 Human organic anion transporter hOAT4 is a transporter of perfluorooctanoic acid.
18501590 Functional differences in steroid uptake of SLC22A9 and SLC02B1 in human placenta are reported.
18466105 Review summarizes current knowledge on the functional and phenotypic consequences of genetic variation in intestinally, hepatically and renally expressed members of solute carrier family (SLC22) member 9.
18414781 The regulatory single nucleotide polymorphism (SNP) of OAT4 found in the promoter region of nephrectomized patients is unlikely to influence mRNA expression or promoter activity of OAT4.
18365245 The data provide a model for the concerted action of OAT1 mediating apical secretion of glutarate derivatives from proximal tubule cells
17393504 OAT7 is the first liver-specific transporter among members of the organic anion transporters of SLC22 family.
17341544 Both progesterone and activation of PKC inhibited hOAT4 activity through redistribution of the transporter from cell surface to the intracellular compartments.
12409283 uptake of steroid sulfates by isolated trophoblasts is mediated by OATP-B and OAT-4 suggesting a physiological role of both carrier proteins in placental uptake of fetal-derived steroid sulfates.

AA Sequence

MAFQDLLGHAGDLWRFQILQTVFLSIFAVATYLHFMLENFTAFIPGHRCWVHILDNDTVSDNDTGALSQD      1 - 70
ALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCD     71 - 140
SQSLTSVAKFVFMAGMMVGGILGGHLSDRFGRRFVLRWCYLQVAIVGTCAALAPTFLIYCSLRFLSGIAA    141 - 210
MSLITNTIMLIAEWATHRFQAMGITLGMCPSGIAFMTLAGLAFAIRDWHILQLVVSVPYFVIFLTSSWLL    211 - 280
ESARWLIINNKPEEGLKELRKAAHRSGMKNARDTLTLEILKSTMKKELEAAQKKKPSLCEMLHMPNICKR    281 - 350
ISLLSFTRFANFMAYFGLNLHVQHLGNNVFLLQTLFGAVILLANCVAPWALKYMNRRASQMLLMFLLAIC    351 - 420
LLAIIFVPQEMQTLREVLATLGLGASALANTLAFAHGNEVIPTIIRARAMGINATFANIAGALAPLMMIL    421 - 490
SVYSPPLPWIIYGVFPFISGFAFLLLPETRNKPLFDTIQDEKNERKDPREPKQEDPRVEVTQF           491 - 553
//

Text Mined References (18)

PMID Year Title
22566634 2012 The genetic architecture of economic and political preferences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19371258 2009 Human organic anion transporter hOAT4 is a transporter of perfluorooctanoic acid.
18501590 2008 Functional differences in steroid sulfate uptake of organic anion transporter 4 (OAT4) and organic anion transporting polypeptide 2B1 (OATP2B1) in human placenta.
18466105 2008 Pharmacogenetics of OATP (SLC21/SLCO), OAT and OCT (SLC22) and PEPT (SLC15) transporters in the intestine, liver and kidney.
18414781 2008 Analysis of regulatory polymorphisms in organic ion transporter genes (SLC22A) in the kidney.
18365245 2008 Organic anion transporters OAT1 and OAT4 mediate the high affinity transport of glutarate derivatives accumulating in patients with glutaric acidurias.
17393504 2007 Novel liver-specific organic anion transporter OAT7 that operates the exchange of sulfate conjugates for short chain fatty acid butyrate.
17341544 2007 Regulation of human organic anion transporter 4 by progesterone and protein kinase C in human placental BeWo cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...