Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

Synonym

Accession Q8IVM7
Symbols C13orf29
NCRNA00346

Gene

 Compartment GO Term (0)

AA Sequence

MRPQPRGGSGRKENTGEEREGRAERYHAISADGERRLQPGTAVLTRHVSFLFGGREAEEHVMETDRVEGA      1 - 70
RDGDKRKEVCFVPIQGSFCFMRLTCARLVAALDIHGLSFSLRFCGSRDTKHEDITGREGQVTPLPRGTPQ     71 - 140
LCTARVGLSSPRTRGQGVPISCKT                                                  141 - 164
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.