Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 5.7e-03

Expression

Synonym

Accession Q8IVM7
Symbols C13orf29
NCRNA00346

 Compartment GO Term (0)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MRPQPRGGSGRKENTGEEREGRAERYHAISADGERRLQPGTAVLTRHVSFLFGGREAEEHVMETDRVEGA      1 - 70
RDGDKRKEVCFVPIQGSFCFMRLTCARLVAALDIHGLSFSLRFCGSRDTKHEDITGREGQVTPLPRGTPQ     71 - 140
LCTARVGLSSPRTRGQGVPISCKT                                                  141 - 164
//

Text Mined References (3)

PMID Year Title