Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.01
PubTator Score 8.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
psoriasis 6694 2.7e-15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Asthma 385 0.0 0.7
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.066 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 2.7e-15

Gene RIF (1)

AA Sequence

MKPLLETLYLLGMLVPGGLGYDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEV      1 - 70
VTQHFLGVTYETHPMYYLKISQPSGNPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLR     71 - 140
NLDFYVLPVLNIDGYIYTWTTDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPV    141 - 210
SEPETKAVASFIESKKDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKAKYGTNYRV    211 - 280
GSSADILYASSGSSRDWARDIGIPFSYTFELRDSGTYGFVLPEAQIQPTCEETMEAVLSVLDDVYAKHWH    281 - 350
SDSAGRVTSATMLLGLLVSCMSLL                                                  351 - 374
//

Text Mined References (7)

PMID Year Title