Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.48
PubTator Score 32.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Degenerative polyarthritis 93
Disease Target Count P-value
psoriasis 6685 1.78855604309848E-23
ovarian cancer 8492 3.61235301538558E-4
group 3 medulloblastoma 2254 0.0223363416093579

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 0.022
ovarian cancer 1.400 0.000
psoriasis -1.100 0.000

Synonym

Accession Q8IVL6 Q13512 Q15740 Q66K32 Q6NX61 Q7L2T1
Symbols GRCB
LEPREL2
HSU47926

Gene

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRLLRPLLLLLLLPPPGSPEPPGLTQLSPGAPPQAPDLLYADGLRAYAAGAWAPAVALLREALRSQAAL      1 - 70
GRVRLDCGASCAADPGAALPAVLLGAPEPDSGPGPTQGSWERQLLRAALRRADCLTQCAARRLGPGGAAR     71 - 140
LRVGSALRDAFRRREPYNYLQRAYYQLKKLDLAAAAAHTFFVANPMHLQMREDMAKYRRMSGVRPQSFRD    141 - 210
LETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLY    211 - 280
EAIAGHWIQVLQCRQRCVGETATRPGRSFPVPDFLPNQLRRLHEAHAQVGNLSQAIENVLSVLLFYPEDE    281 - 350
AAKRALNQYQAQLGEPRPGLGPREDIQRFILRSLGEKRQLYYAMEHLGTSFKDPDPWTPAALIPEALREK    351 - 420
LREDQEKRPWDHEPVKPKPLTYWKDVLLLEGVTLTQDSRQLNGSERAVLDGLLTPAECGVLLQLAKDAAG    421 - 490
AGARSGYRGRRSPHTPHERFEGLTVLKAAQLARAGTVGSQGAKLLLEVSERVRTLTQAYFSPERPLHLSF    491 - 560
THLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDTGECWREPPAYTYRDYSGLLYLNDDFQGGDLFFTEPN    561 - 630
ALTVTARVRPRCGRLVAFSSGVENPHGVWAVTRGRRCALALWHTWAPEHREQEWIEAKELLQESQEEEEE    631 - 700
EEEEMPSKDPSPEPPSRRHQRVQDKTGRAPRVREEL                                      701 - 736
//

Text Mined References (12)

PMID Year Title
22437554 2012 Genome-wide association study identifies three common variants associated with serologic response to vitamin E supplementation in men.
21269460 2011 Initial characterization of the human central proteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19436308 2009 The prolyl 3-hydroxylases P3H2 and P3H3 are novel targets for epigenetic silencing in breast cancer.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15063763 2004 LEPREL1, a novel ER and Golgi resident member of the Leprecan family.
15044469 2004 Prolyl 3-hydroxylase 1, enzyme characterization and identification of a novel family of enzymes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...