Property Summary

NCBI Gene PubMed Count 10
PubMed Score 85.03
PubTator Score 32.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteoarthritis 184 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115
Disease Target Count P-value
psoriasis 6694 1.8e-23
ovarian cancer 8520 3.6e-04
group 3 medulloblastoma 4104 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.2e-02
ovarian cancer 1.400 3.6e-04
psoriasis -1.100 1.8e-23

Gene RIF (2)

AA Sequence

MLRLLRPLLLLLLLPPPGSPEPPGLTQLSPGAPPQAPDLLYADGLRAYAAGAWAPAVALLREALRSQAAL      1 - 70
GRVRLDCGASCAADPGAALPAVLLGAPEPDSGPGPTQGSWERQLLRAALRRADCLTQCAARRLGPGGAAR     71 - 140
LRVGSALRDAFRRREPYNYLQRAYYQLKKLDLAAAAAHTFFVANPMHLQMREDMAKYRRMSGVRPQSFRD    141 - 210
LETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLY    211 - 280
EAIAGHWIQVLQCRQRCVGETATRPGRSFPVPDFLPNQLRRLHEAHAQVGNLSQAIENVLSVLLFYPEDE    281 - 350
AAKRALNQYQAQLGEPRPGLGPREDIQRFILRSLGEKRQLYYAMEHLGTSFKDPDPWTPAALIPEALREK    351 - 420
LREDQEKRPWDHEPVKPKPLTYWKDVLLLEGVTLTQDSRQLNGSERAVLDGLLTPAECGVLLQLAKDAAG    421 - 490
AGARSGYRGRRSPHTPHERFEGLTVLKAAQLARAGTVGSQGAKLLLEVSERVRTLTQAYFSPERPLHLSF    491 - 560
THLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDTGECWREPPAYTYRDYSGLLYLNDDFQGGDLFFTEPN    561 - 630
ALTVTARVRPRCGRLVAFSSGVENPHGVWAVTRGRRCALALWHTWAPEHREQEWIEAKELLQESQEEEEE    631 - 700
EEEEMPSKDPSPEPPSRRHQRVQDKTGRAPRVREEL                                      701 - 736
//

Text Mined References (13)

PMID Year Title