Property Summary

NCBI Gene PubMed Count 17
PubMed Score 295.25
PubTator Score 24.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
MYOPIA, HIGH, WITH CATARACT AND VITREORETINAL DEGENERATION 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Urinary bladder cancer 36 0.0 2.7

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.500 4.8e-04
Astrocytoma, Pilocytic 2.500 3.2e-10
atypical teratoid / rhabdoid tumor 1.300 2.7e-02
Breast cancer -2.800 4.1e-24
breast carcinoma -1.500 8.9e-05
cystic fibrosis -1.964 5.9e-06
ductal carcinoma in situ -1.100 1.0e-03
ependymoma 2.100 7.3e-09
glioblastoma 1.200 1.3e-03
interstitial cystitis -1.600 2.0e-04
invasive ductal carcinoma -1.057 1.2e-03
lung adenocarcinoma -1.500 1.9e-07
lung cancer -2.300 1.1e-03
lung carcinoma -2.700 1.5e-27
malignant mesothelioma -4.000 1.1e-09
non-small cell lung cancer -1.415 2.3e-05
osteosarcoma 3.583 5.1e-09
ovarian cancer 1.900 6.9e-03
pulmonary arterial hypertension -3.400 4.5e-02
subependymal giant cell astrocytoma 2.574 1.7e-02
urothelial carcinoma -2.200 6.4e-05

Gene RIF (9)

AA Sequence

MRERIWAPPLLLLLPLLLPPPLWGGPPDSPRRELELEPGPLQPFDLLYASGAAAYYSGDYERAVRDLEAA      1 - 70
LRSHRRLREIRTRCARHCAARHPLPPPPPGEGPGAELPLFRSLLGRARCYRSCETQRLGGPASRHRVSED     71 - 140
VRSDFQRRVPYNYLQRAYIKLNQLEKAVEAAHTFFVANPEHMEMQQNIENYRATAGVEALQLVDREAKPH    141 - 210
MESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTECRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQV    211 - 280
LVCQHECVRELATRPGRLSPIENFLPLHYDYLQFAYYRVGEYVKALECAKAYLLCHPDDEDVLDNVDYYE    281 - 350
SLLDDSIDPASIEAREDLTMFVKRHKLESELIKSAAEGLGFSYTEPNYWIRYGGRQDENRVPSGVNVEGA    351 - 420
EVHGFSMGKKLSPKIDRDLREGGPLLYENITFVYNSEQLNGTQRVLLDNVLSEEQCRELHSVASGIMLVG    421 - 490
DGYRGKTSPHTPNEKFEGATVLKALKSGYEGRVPLKSARLFYDISEKARRIVESYFMLNSTLYFSYTHMV    491 - 560
CRTALSGQQDRRNDLSHPIHADNCLLDPEANECWKEPPAYTFRDYSALLYMNDDFEGGEFIFTEMDAKTV    561 - 630
TASIKPKCGRMISFSSGGENPHGVKAVTKGKRCAVALWFTLDPLYRELERIQADEVIAILDQEQQGKHEL    631 - 700
NINPKDEL                                                                  701 - 708
//

Text Mined References (19)

PMID Year Title