Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.62
PubTator Score 14.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Hepatitis 61
Disease Target Count P-value
breast carcinoma 1614 8.57438594668221E-20
Breast cancer 3099 3.00481990907595E-11
malignant mesothelioma 3163 2.11042869870911E-9
psoriasis 6685 4.87445325648502E-9
group 4 medulloblastoma 1875 2.03134239472487E-7
ovarian cancer 8492 4.76733402236706E-6
Pick disease 1893 3.6962843275203E-4
pituitary cancer 1972 0.00128304632193794
astrocytoma 1493 0.00136078365481263
oligodendroglioma 2849 0.00277612399388375
osteosarcoma 7933 0.0484517023950714
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Influenza 142 3.979 2.0

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -4.600 0.000
oligodendroglioma 1.900 0.003
psoriasis -1.300 0.000
astrocytoma 2.100 0.001
osteosarcoma -1.054 0.048
group 4 medulloblastoma -2.700 0.000
Breast cancer -2.600 0.000
breast carcinoma -1.600 0.000
Pick disease 1.500 0.000
ovarian cancer 1.800 0.000
pituitary cancer -2.000 0.001

Synonym

Accession Q8IVL1 A6NEC1 Q8IVK3 Q8IVK4 Q8IVK5 Q8IVK6 Q8IVK7 Q8IVK8 Q8NHC9 Q8NHD0 Q8TDE9 Q8TDF0 Q8TEB3 Q96B30 Q9NUZ6 Q9NVM7 Q9P2C8
Symbols HELAD1
RAINB1
POMFIL2
UNC53H2
STEERIN2

Gene

PDB

2YRN  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
24161943 interaction between NAV2 and 14-3-3epsilon
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12214280 a novel gene, termed HELAD1 (helicase, APC down-regulated 1) plays important role in colorectal carcinogenesis (HELAD1)
11904404 regulated by all-trans retinoic acid in neuroblastoma cells

AA Sequence

MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKSQVLQGLQEPA      1 - 70
GEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCP     71 - 140
KNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQQPQKQHLSSPLPPAV    141 - 210
SQVAGAPSQCQAGTPQQQVPVTPQAPCQPHQPAPHQQSKAQAEMQSSASSKDSSQSKIIRFTLGQKKISR    211 - 280
LPGPTARVSAAGSEAKTRGGSTTANNRRSQSFNNYDKSKPVTSPPPPPSSHEKEPLASSASSHPGMSDNA    281 - 350
PASLESGSSSTPTNCSTSSAIPQPGAATKPWRSKSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNN    351 - 420
QKSMLEKLKLFNSKGGSKAGEGPGSRDTSCERLETLPSFEESEELEAASRMLTTVGPASSSPKIALKGIA    421 - 490
QRTFSRALTNKKSSLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLKEEPKEDPSGAAVPEMPKKSS    491 - 560
KIASFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSPSAPAPSKEGERSRSGKLSSGLPQQKPQLDG    561 - 630
RHSSSSSSLASSEGKGPGGTTLNHSISSQTVSGSVGTTQTTGSNTVSVQLPQPQQQYNHPNTATVAPFLY    631 - 700
RSQTDTEGNVTAESSSTGVSVEPSHFTKTGQPALEELTGEDPEARRLRTVKNIADLRQNLEETMSSLRGT    701 - 770
QVTHSTLETTFDTNVTTEMSGRSILSLTGRPTPLSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTE    771 - 840
SGRYVYSAPLRRQLASRGSSVCHVDVSDKAGDEMDLEGISMDAPGYMSDGDVLSKNIRTDDITSGYMTDG    841 - 910
GLGLYTRRLNRLPDGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYAN    911 - 980
TPASSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDESDKSTSGKK    981 - 1050
NPVISQTGSWRRGMTAQVGITMPRTKPSAPAGALKTPGTGKTDDAKVSEKGRLSPKASQVKRSPSDAGRS   1051 - 1120
SGDESKKPLPSSSRTPTANANSFGFKKQSGSAAGLAMITASGVTVTSRSATLGKIPKSSALVSRSAGRKS   1121 - 1190
SMDGAQNQDDGYLALSSRTNLQYRSLPRPSKSNSRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTA   1191 - 1260
LGSSLPGLVNQTDKEKGISSDNESVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLRRLFGGKP   1261 - 1330
TKQVPIATAENMKNSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPLASSPSSAHSA   1331 - 1400
PSNSLTWGTNASSSSAVSKDGLGFQSVSSLHTSCESIDISLSSGGVPSHNSSTGLIASSKDDSLTPFVRT   1401 - 1470
NSVKTTLSESPLSSPAASPKFCRSTLPRKQDSDPHLDRNTLPKKGLRYTPTSQLRTQEDAKEWLRSHSAG   1471 - 1540
GLQDTAANSPFSSGSSVTSPSGTRFNFSQLASPTTVTQMSLSNPTMLRTHSLSNADGQYDPYTDSRFRNS   1541 - 1610
SMSLDEKSRTMSRSGSFRDGFEEESWEKSSVDNFVSRLHSSLHFSLPLFHHARYELVHGSSLSLVSSTSS   1611 - 1680
VYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQSLTMTAEQKDSELN   1681 - 1750
ELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRRQHSSDSVSSINSATSHSSVGSNIE   1751 - 1820
SDSKKKKRKNWVNELRSSFKQAFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSN   1821 - 1890
SLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSES   1891 - 1960
QGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWK   1961 - 2030
EDSRPHLFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTSETPE   2031 - 2100
LLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILSGPSGTGKTYLANRL   2101 - 2170
SEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENNAVDMPLVIILDNLHHVSSLGEIFN   2171 - 2240
GLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEISGRVRNME   2241 - 2310
LVKIIDWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQL   2311 - 2380
YGRRAPWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPPSDAEGDPLMNM   2381 - 2450
LMRLQEAANYSSPQSYDSDSNSNSHHDDILDSSLESTL                                   2451 - 2488
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24161943 2013 14-3-3? and NAV2 interact to regulate neurite outgrowth and axon elongation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...