Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.85
PubTator Score 20.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.022 5.9e-03
adult high grade glioma -1.900 2.1e-02
aldosterone-producing adenoma -1.765 1.6e-03
Alzheimer's disease -1.200 3.0e-02
astrocytoma -1.600 2.0e-16
Astrocytoma, Pilocytic -1.400 8.3e-03
Atopic dermatitis -1.300 3.2e-04
atypical teratoid / rhabdoid tumor -1.900 6.0e-03
Breast cancer -1.200 3.3e-02
breast carcinoma -1.400 1.5e-06
ependymoma -1.800 1.5e-02
glioblastoma -1.600 1.9e-03
group 3 medulloblastoma -2.300 3.0e-02
interstitial cystitis -1.300 1.8e-02
intraductal papillary-mucinous adenoma (... -1.600 7.5e-03
intraductal papillary-mucinous carcinoma... -1.700 6.8e-03
invasive ductal carcinoma -1.500 2.2e-03
medulloblastoma, large-cell -3.100 4.2e-05
oligodendroglioma -1.100 1.6e-02
ovarian cancer -2.900 8.8e-15
Pick disease -1.700 1.2e-03
psoriasis 1.200 1.3e-06
subependymal giant cell astrocytoma -1.745 1.9e-02
urothelial carcinoma -1.100 2.0e-03

 GO Component (1)

Gene RIF (11)

AA Sequence

MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQHCSSRPLELTETESSMLSCQLALKSTCEFGEKKPL      1 - 70
QGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIE     71 - 140
NVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVELQQRVTHASPPS    141 - 210
EASQAKTQQDMQSSLAARYATQSNHSGIATSQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSID    211 - 280
KNKPPNYANGNEKDSSKGPQSSSGVNGNVQPPSTAGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTV    281 - 350
KQSSTATSPTPSSDRLKPPVSEGVKTAPSGQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSES    351 - 420
GEMEGFNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCTEKPVKEEKDQ    421 - 490
VTEMAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTVKQTISPGSTASKESEKFRTTKGS    491 - 560
PSQSLSKPITMEKASASSCPAPLEGREAGQASPSGSCTMTVAQSSGQSTGNGAVQLPQQQQHSHPNTATV    561 - 630
APFIYRAHSENEGTALPSADSCTSPTKMDLSYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETM    631 - 700
SSLRGTQISHSTLETTFDSTVTTEVNGRTIPNLTSRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTSR    701 - 770
FIHTDPSRFMYTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGY    771 - 840
MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTTSSVSS    841 - 910
YSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKAS    911 - 980
LSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGK    981 - 1050
KPPSGIGRSTATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQ   1051 - 1120
DDVVLHVSSKTTLQYRSLPRPSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSS   1121 - 1190
PVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKS   1191 - 1260
ASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLA   1261 - 1330
SSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLL   1331 - 1400
MRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSS   1401 - 1470
AAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDS   1471 - 1540
MEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMT   1541 - 1610
GRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSAT   1611 - 1680
SHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNA   1681 - 1750
GDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLE   1751 - 1820
ALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLN   1821 - 1890
ITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKDQKSQAYLIGSIGVSGKTKWDVLDGVIRRL   1891 - 1960
FKEYVFRIDTSTSLGLSSDCIASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVF   1961 - 2030
DTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQ   2031 - 2100
QYLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHH   2101 - 2170
NFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGP   2171 - 2240
RLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQESPA   2241 - 2310
LLQLRPEDVGYESCTSTKEATTSKHIPQTDTEGDPLMNMLMKLQEAANYSSTQSCDSESTSHHEDILDSS   2311 - 2380
LESTL                                                                    2381 - 2385
//

Text Mined References (25)

PMID Year Title