Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.79
PubTator Score 20.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
urothelial carcinoma -1.100 0.002
ependymoma -2.000 0.000
oligodendroglioma -1.800 0.000
astrocytoma -1.700 0.006
glioblastoma -3.000 0.016
group 4 medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -2.300 0.001
medulloblastoma, large-cell -3.700 0.000
Atopic dermatitis -1.300 0.000
adrenocortical carcinoma -2.259 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.008
intraductal papillary-mucinous carcinoma... -1.700 0.007
breast carcinoma -1.400 0.000
interstitial cystitis -1.300 0.018
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -1.800 0.000
aldosterone-producing adenoma -1.765 0.002
subependymal giant cell astrocytoma -1.745 0.019
psoriasis 1.200 0.000
Alzheimer's disease -1.200 0.030
Pick disease -1.700 0.001
Breast cancer -1.600 0.000
invasive ductal carcinoma -2.100 0.001
ovarian cancer -2.900 0.000

Synonym

Accession Q8IVL0 Q8NFW7 Q9Y2E7
Symbols POMFIL1
unc53H3
STEERIN3

Gene

Gene RIF (11)

PMID Text
26210448 Together, our findings suggest an important role for miR-21 in the progression of HCC, which negatively regulated Navigator-3 in the migration of HCC.
25678558 The authers propose that NAV3 inhibits breast cancer progression by regulating microtubule dynamics, biasing directionally persistent rather than random migration, and inhibiting locomotion of initiated cells.
23097141 Data indicate that neuron navigator 3 (NAV3) may be a potential new prognostic biomarker and a potential therapeutic target.
22173670 NAV3 has a role in linking tissue inflammation to cancer development in the colon.
21995814 characterized copy number changes of NAV3 in 24 basal cell cancers, eight squamous cell cancers and eight non-malignant inflammatory skin lesions
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626031 NAV3 gene would not be frequently deleted in cutaneous type leukemia/lymphoma including those with mycosis fungoides-like manifestations
18509363 An imbalanced fluorescence in situ hybridization pattern between NAV3 and pericentromeric control probes was seen in three patients in accordance with CGH array data. No NAV3 specific breakpoint or partial deletion was detected.
More...

AA Sequence

MPVLGVASKLRQPAVGSKPVHTALPIPNLGTTGSQHCSSRPLELTETESSMLSCQLALKSTCEFGEKKPL      1 - 70
QGKAKEKEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKVEDINGCPRSQSQMIE     71 - 140
NVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQQQHHQQQYYQSLVELQQRVTHASPPS    141 - 210
EASQAKTQQDMQSSLAARYATQSNHSGIATSQKKPTRLPGPSRVPAAGSSSKVQGASNLNRRSQSFNSID    211 - 280
KNKPPNYANGNEKDSSKGPQSSSGVNGNVQPPSTAGQPPASAIPSPSASKPWRSKSMNVKHSATSTMLTV    281 - 350
KQSSTATSPTPSSDRLKPPVSEGVKTAPSGQKSMLEKFKLVNARTALRPPQPPSSGPSDGGKDDDAFSES    351 - 420
GEMEGFNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCTEKPVKEEKDQ    421 - 490
VTEMAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKVPTVKQTISPGSTASKESEKFRTTKGS    491 - 560
PSQSLSKPITMEKASASSCPAPLEGREAGQASPSGSCTMTVAQSSGQSTGNGAVQLPQQQQHSHPNTATV    561 - 630
APFIYRAHSENEGTALPSADSCTSPTKMDLSYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETM    631 - 700
SSLRGTQISHSTLETTFDSTVTTEVNGRTIPNLTSRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTSR    701 - 770
FIHTDPSRFMYTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSSEVDVGGYMSDGDILGKSLRTDDINSGY    771 - 840
MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNISTDDLNTTSSVSS    841 - 910
YSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKAS    911 - 980
LSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGK    981 - 1050
KPPSGIGRSTATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQ   1051 - 1120
DDVVLHVSSKTTLQYRSLPRPSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSS   1121 - 1190
PVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSKYPDIASPTFRRLFGAKAGGKS   1191 - 1260
ASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLA   1261 - 1330
SSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLL   1331 - 1400
MRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSS   1401 - 1470
AAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDS   1471 - 1540
MEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMT   1541 - 1610
GRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSAT   1611 - 1680
SHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNA   1681 - 1750
GDCGSASMKPSQSASASPLVWPPKKRQNGPVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLE   1751 - 1820
ALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLN   1821 - 1890
ITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGYGRAKDQKSQAYLIGSIGVSGKTKWDVLDGVIRRL   1891 - 1960
FKEYVFRIDTSTSLGLSSDCIASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVF   1961 - 2030
DTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTYLANKLAEYVITKSGRKKTEDAIATFNVDHKSSKELQ   2031 - 2100
QYLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHH   2101 - 2170
NFRWVLCANHTEPVKGFLGRYLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGP   2171 - 2240
RLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRTPWEDPSKWVLDTYPWSSATLPQESPA   2241 - 2310
LLQLRPEDVGYESCTSTKEATTSKHIPQTDTEGDPLMNMLMKLQEAANYSSTQSCDSESTSHHEDILDSS   2311 - 2380
LESTL                                                                    2381 - 2385
//

Text Mined References (25)

PMID Year Title
26210448 2015 MiR-21 promoted proliferation and migration in hepatocellular carcinoma through negative regulation of Navigator-3.
25678558 2015 Navigator-3, a modulator of cell migration, may act as a suppressor of breast cancer progression.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23097141 2013 Neuron navigator 3 alterations in nervous system tumors associate with tumor malignancy grade and prognosis.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22173670 2012 Potential role of a navigator gene NAV3 in colorectal cancer.
21995814 2011 NAV3 copy number changes and target genes in basal and squamous cell cancers.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20707712 2010 A genome-wide association study of self-rated health.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...