Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (1)

PMID Text
12057858 mRNA is expressed in the mammary gland as splicing variants and encodes various aberrant truncated proteins

AA Sequence

MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP                             1 - 47
//

Text Mined References (2)

PMID Year Title
12588680 Expression of potential lymphocyte trafficking mediator molecules in the mammary gland.
12057858 2002 Human GlyCAM-1 mRNA is expressed in the mammary gland as splicing variants and encodes various aberrant truncated proteins.