Property Summary

NCBI Gene PubMed Count 21
PubMed Score 76.61
PubTator Score 35.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 3.79196795609022E-5
medulloblastoma, large-cell 6234 9.98416388991987E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00154972751190125
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00208492556178146
active ulcerative colitis 477 0.00226701057599025
osteosarcoma 7933 0.00625298184129587
active Crohn's disease 918 0.00697708267583696
primary pancreatic ductal adenocarcinoma 1271 0.00719062048453952
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0226258210386242
ependymoma 2514 0.043349744783353
Disease Target Count Z-score Confidence
Parkinson's disease 364 3.439 1.7
Disease Target Count Z-score Confidence
Azoospermia 89 3.692 1.8
Nephronophthisis 74 3.631 1.8

Expression

Synonym

Accession Q8IVJ1 Q63HJ4 Q658Z5 Q659A4 Q6MZK2
Symbols MgtE

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26355001 Na+-dependent Mg2+ efflux conducted by Na+/Mg2+ exchanger SLC41A1 is regulated by insulin.
26308152 Authors performed direct DNA sequencing of the SLC41A1 gene in 100 early-onset PD cases.
24661466 This study has shown loss of Mg(2+) efflux function consequent to SLC41A1 R244H variant and SLC41A1 coding variants seem to be rare in Taiwanese Parkinson disease.
23976986 Alanine350Valine substitution in Na/Mg(2) exchanger SLC41A1, potentially associated with Parkinson's disease, is a gain-of-function mutation.
23844728 SLC41A1 is significantly overexpressed in nearly 55% of preeclamptic placentas
23823179 Binding partners of SLC41A1, were identified.
23661805 In normal human kidney tissue, endogenous SLC41A1 specifically localized to renal tubules situated at the corticomedullary boundary, consistent with the region of cystogenesis observed in nephronophthisis.
22031603 The human SLC41A1 gene encodes for the Na+/Mg(2)+ exchanger, the predominant Mg(2)+ efflux system.
21812739 Direct DNA sequencing of the SLC41A1 and RAB7L1 genes within the PARK16 locus in 205 Chinese Parkinson's disease patients shows no significant difference with controls.
21696366 Results indicate that SLC41A1 proteins are a central component of Mg(2+) transport systems, and that their Mg(2+) transport function is regulated primarily through an endosomal recycling mechanism involving the SLC41A1 N-terminal cytoplasmic domain.
More...

AA Sequence

MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGVREEDALLENG      1 - 70
SQSNESDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVLDIVQHWEVFQKVTEVFILVP     71 - 140
ALLGLKGNLEMTLASRLSTAANIGHMDTPKELWRMITGNMALIQVQATVVGFLASIAAVVFGWIPDGHFS    141 - 210
IPHAFLLCASSVATAFIASLVLGMIMIGVIIGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLE    211 - 280
LNHWRYIYPLVCAFFVALLPVWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMA    281 - 350
VFTPVINGVGGNLVAVQASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGH    351 - 420
LVFLYTISCMQGGHTTLTLIFIIFYMTAALLQVLILLYIADWMVHWMWGRGLDPDNFSIPYLTALGDLLG    421 - 490
TGLLALSFHVLWLIGDRDTDVGD                                                   491 - 513
//

Text Mined References (22)

PMID Year Title
26355001 2015 Insulin Modulates the Na+/Mg2+ Exchanger SLC41A1 and Influences Mg2+ Efflux from Intracellular Stores in Transgenic HEK293 Cells.
26308152 2015 Genetic analysis of SLC41A1 in Chinese Parkinson's disease patients.
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
24661466 2014 Variant R244H in Na+/Mg2+ exchanger SLC41A1 in Taiwanese Parkinson's disease is associated with loss of Mg2+ efflux function.
23976986 2013 Substitution p.A350V in Na?/Mg²? exchanger SLC41A1, potentially associated with Parkinson's disease, is a gain-of-function mutation.
23844728 2013 SLC41A1 is the only magnesium responsive gene significantly overexpressed in placentas of preeclamptic women.
23823179 Nature of SLC41A1 complexes: report on the split-ubiquitin yeast two hybrid assay.
23661805 2013 Mutation of the Mg2+ transporter SLC41A1 results in a nephronophthisis-like phenotype.
23269536 2013 Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population.
More...