Property Summary

NCBI Gene PubMed Count 23
PubMed Score 82.11
PubTator Score 35.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

AA Sequence

MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGVREEDALLENG      1 - 70
SQSNESDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVLDIVQHWEVFQKVTEVFILVP     71 - 140
ALLGLKGNLEMTLASRLSTAANIGHMDTPKELWRMITGNMALIQVQATVVGFLASIAAVVFGWIPDGHFS    141 - 210
IPHAFLLCASSVATAFIASLVLGMIMIGVIIGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLE    211 - 280
LNHWRYIYPLVCAFFVALLPVWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMA    281 - 350
VFTPVINGVGGNLVAVQASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGH    351 - 420
LVFLYTISCMQGGHTTLTLIFIIFYMTAALLQVLILLYIADWMVHWMWGRGLDPDNFSIPYLTALGDLLG    421 - 490
TGLLALSFHVLWLIGDRDTDVGD                                                   491 - 513
//

Text Mined References (24)

PMID Year Title